![]() Bispecific binding molecules binding to VEGF and Ang2
专利摘要:
Bispecifc binding molecules binding to both VEGF and Ang2, preferably in the form of immunoglobulin single variable domains like VHHs and domain antibodies, pharmaceutical compositions containing the same and their use in the treatment of diseases that are associated with VEGF- and/or Ang2- mediated effects on angiogenesis are disclosed. Further, nucleic acids encoding bispecific binding molecules, host cells and methods for preparing same are also described. 公开号:AU2012237234A1 申请号:U2012237234 申请日:2012-03-30 公开日:2013-09-05 发明作者:Joachim Boucneau;Marie-Ange Buyse;Erik Depla;Andreas Gschwind;Rene Georg OTT 申请人:Boehringer Ingelheim International GmbH; IPC主号:C07K16-22
专利说明:
WO 2012/131078 PCT/EP2012/055901 Bispecific binding molecules binding to VEGF and Ang2 5 FIELD OF THE INVENTION The invention relates to the field of human therapy, in particular cancer therapy and agents and compositions useful in such therapy. BACKGROUND OF THE INVENTION When tumors reach a critical size of approximately 1 mm 3 they become dependent on 10 angiogenesis for maintaining blood supply with oxygen and nutritients to allow for further growth. Anti-angiogenesis therapies have become an important treatment option for several types of tumors. These therapies have focused on blocking the VEGF pathway (Ferrara et al., Nat Rev Drug Discov. 2004 May;3(5):391-400.) by neutralizing VEGF (Avastin) or its receptors (Sutent and Sorafinib). Recent studies in mice have shown, is that Angiopoietin2 (Ang2), a ligand of the Tie2 receptor, controls vascular remodeling by enabling the functions of other angiogenic factors, such as VEGF. Ang2 is primarily expressed by endothelial cells, strongly induced by hypoxia and other angiogenic factors and has been demonstrated to regulate tumor vessel plasticity, allowing vessels to respond to VEGF and FGF2 (Augustin et al., Nat Rev Mol Cell Biol. 2009 Mar;10(3):165-77.). 20 Consistent with this role, the deletion or inhibition of Ang2 results in reduced angiogenesis (Gale et al., Dev Cell. 2002 Sep;3(3):302-4.) (Falc6n et al., Am J Pathol. 2009 Nov;175(5):2159-70.). Elevated Ang2 serum concentrations have been reported for patients with colorectal cancer, NSCLC and melanoma (Goede et al., Br J Cancer. 2010 Oct 26;103(9):1407-14),(Park et al., Chest. 2007 Jul;132(1): 200-6.),(Helfrich et al., 25 Clin Cancer Res. 2009 Feb 15;15(4):1384-92.). In CRC cancer Ang2 serum levels correlate with therapeutic response to anti-VEGF therapy. The Ang-Tie system consists of 2 receptors (Tie1 and Tie2) and 3 ligands (Ang1, Ang2 and Ang4) (Augustin et al., Nat Rev Mol Cell Biol. 2009 Mar;10(3):165-77.). Tie2, Ang1 and Ang2 are the best studied members of this family, Tiel is an orphan receptor and 30 the role of Ang4 for vascular remodelling still needs to be defined. Ang2 and Ang1 1 WO 2012/131078 PCT/EP2012/055901 mediate opposing functions upon Tie2 binding and activation. Ang2-mediated Tie2 activation results in endothelial cell activation, pericyte dissociation, vessel leakage and induction of vessel sprouting. In contrast to Ang2, Ang1 signaling maintains vessel integrity by recruitment of pericytes, thereby maintaining endothelial cell quiescence. 5 Angiopoietin 2 (Ang2) is a secreted, 66 kDa ligand for the Tie2 receptor tyrosine kinase (Augustin et al., Nat Rev Mol Cell Biol. 2009 Mar;10(3):165-77.). Ang2 consists of an N terminal coiled-coil domain and a C-terminal fibrinogen-like domain, the latter is required for Tie2 interaction. Ang2 is primarily expressed by endothelial cells and strongly induced by hypoxia and other angiogenic factors, including VEGF. Tie2 is found on 10 endothelial cells, haematopoietic stem cells and tumor cells. Ang2-Tie2 has been demonstrated to regulate tumor vessel plasticity, allowing vessels to respond to VEGF and FGF2. In vitro Ang2 has been shown to act as a modest mitogen, chemoattractant and inducer of tube formation in human umbilical vein endothelial cells (HUVEC). Ang2 induces 15 tyrosine phosphorylation of ectopically expressed Tie2 in fibroblasts and promotes downstream signaling events, such as phosphorylation of ERK-MAPK, AKT and FAK in HUVEC. An antagonistic role of Ang2 in Ang1-induced endothelial cell responses has been described. Ang2 -deficiency has been shown to result in a profound lymphatic patterning defect in 20 mice. Although the loss of Ang2 is dispensable for embryonic vascular development, Ang2 -deficient mice have persistent vascular defects in the retina and kidney. Together with the dynamic pattern of Ang2 expression at sites of angiogenesis (for example ovary), these findings indicate that Ang2 controls vascular remodeling by enabling the functions of other angiogenic factors, such as VEGF. 25 The Ang2-Tie2 system exerts crucial roles during the angiogenic switch and later stages of tumor angiogenesis. Ang2 expression is strongly up-regulated in the tumor-associated endothelium. Reduced growth of tumors has been observed when implanted into Ang2 deficient mice, especially during early stages of tumor growth. Therapeutic blocking of Ang2 with Ang2 mAbs has shown broad efficacy in a variety of tumor xenograft models. 2 WO 2012/131078 PCT/EP2012/055901 Additive effects of Ang2 mAbs with inhibitors of VEGFR2 (mAbs and small molecular weight inhibitors) have been described. As described in e.g. US2008/0014196 and W02008/101985, angiogenesis is implicated in the pathogenesis of a number of disorders, including solid tumors and metastasis as 5 well as eye diseases. One of the most important pro-angiogenic factors is vascular endothelial growth factor (VEGF), also termed VEGF-A or vascular permeability factor (VPF). VEGF belongs to a gene family that includes placenta growth factor (PIGF), VEGF-B, VEGF-C, VEGF-D, VEGF-E and VEGF-F. Alternative splicing of mRNA of a single gene of human VEGF results in at least six isoforms (VEGF121, VEGF145, 10 VEGF165, VEGF183, VEGF189, and VEGF206), VEGF165 being the most abundant isoform. Two VEGF tyrosine kinase receptors (VEGFR) have been identified that interact with VEGF, i.e. VEGFR-1 (also known as FIt-1) and VEGFR-2 (also known as KDR or FIK-1). VEGFR-1 has the highest affinity for VEGF, while VEGFR- 2 has a somewhat 15 lower affinity for VEGF. Ferrara (Endocrine Rev. 2004, 25: 581-611) provide a detailed description of VEGF, the interaction with its receptors and its function in normal and pathological processes can be found in Hoeben et al. Pharmacol. Rev. 2004, 56: 549-580. VEGF has been reported to be a pivotal regulator of both normal and abnormal 20 angiogenesis (Ferrara and Davis-Smyth, Endocrine Rev. 1997, 18: 4-25; Ferrara J. MoL Med. 1999, 77: 527-543). Compared to other growth factors that contribute to the processes of vascular formation, VEGF is unique in its high specificity for endothelial cells within the vascular system. VEGF mRNA is overexpressed by the majority of human tumors. In the case of tumor 25 growth, angiogenesis appears to be crucial for the transition from hyperplasia to neoplasia, and for providing nourishment for the growth and metastasis of the tumor (Folkman et a., 1989, Nature 339-58), which allows the tumor cells to acquire a growth advantage compared to the normal cells. Therefore, anti-angiogenesis therapies have become an important treatment option for several types of tumors. These therapies have 3 WO 2012/131078 PCT/EP2012/055901 focused on blocking the VEGF pathway (Ferrara et al., Nat Rev Drug Discov. 2004 May; 3(5): 391-400. VEGF is also involved in eye diseases. The concentration of VEGF in eye fluids is highly correlated with the presence of active proliferation of blood vessels in patients with 5 diabetic and other ischemia-related retinopathies. Furthermore, recent studies have demonstrated the localization of VEGF in choroidal neovascular membranes in patients affected by age-related macular degeneration (AMD). Up-regulation of VEGF has also been observed in various inflammatory disorders. VEGF has been implicated in the pathogenesis of rheutatoid arthritis, an inflammatory disease in which angiogenesis 10 plays a significant role. The elucidation of VEGF and its role in angiogenesis and different processes has provided a potential new target of therapeutic intervention. The function of VEGF has been inhibited by small molecules that block or prevent activation of VEGF receptor tyrosine kinases (Schlaeppi and Wood, 1999, Cancer Metastasis Rev., 18: 473-481) and 15 consequently interfere with the VEGF receptor signal transduction pathway. Cytotoxic conjugates containing bacterial or plant toxins can inhibit the stimulating effect of VEGF on tumor angiogenesis. VEGF-DT385 toxin conjugates (diphtheria toxin domains fused or chemically conjugated to VEGF165), for example, efficiently inhibit tumor growth in vivo. Tumor growth inhibition could also be achieved by delivering a F1k-1 mutant or 20 soluble VEGF receptors by a retrovirus. VEGF-neutralizing antibodies, such as A4.6.1 and MV833, have been developed to block VEGF from binding to its receptors and have shown preclinical antitumor activity (Kim et al. Nature 1993, 362: 841-844; Folkman Nat. Med. 1995, 1: 27-31; Presta et al. Cancer Res. 1997, 57: 4593-4599; Kanai et al. Int. J. Cancer 1998, 77: 933-936; Ferrara and 25 Alitalo Nat. Med. 1999, 5: 1359-1364; 320, 340. For a review of therapeutic anti-VEGF approaches trials, see Campochiaro and Hackett (Oncogene 2003, 22: 6537-6548). Most clinical experience has been obtained with A4.6.1, also called bevacizumab (Avastin@; Genentech, San Francisco, CA). 4 WO 2012/131078 PCT/EP2012/055901 W02008/101985 describes immunoglobulin single variable domains from camelides (VHHs or "Nanobodies@, as defined herein) that bind to VEGF, and their use in the treatment of conditions and diseases characterized by excessive and/or pathological angiogenesis or neovascularization. 5 It has been an object of the present invention to provide novel anti-angiogenic binding molecules for human therapy. It has been a further object of the invention to provide methods for the prevention, treatment, alleviation and/or diagnosis of such diseases, disorders or conditions, involving the use and/or administration of such binding molecules and compositions 10 comprising them. In particular, it is has been an object of the invention to provide such pharmacologically active binding molecules, compositions and/or methods that provide advantages compared to the agents, compositions and/or methods currently used and/or known in the art. These advantages include improved therapeutic and/or pharmacological properties and/or other advantageous properties, e.g. for 15 manufacturing purposes, especially as compared to conventional antibodies as those described above, or fragments thereof. BRIEF SUMMARY OF THE INVENTION According to a first aspect, there are provided bispecific binding molecules, preferably 20 bispecific immunoglobulins, preferably immunoglobulin single variable domains like VHHs and domain antibodies, which comprise at least one VEGF-binding component and at least one Ang2-binding component in a single molecule. Preferably, said bispecific binding molecules further comprise a serum albumin binding component. More specifically, a bispecific binding molecule of the invention essentially comprises (i) 25 a Ang2-binding component specifically binding to at least one epitope of Ang2 and (ii) a VEGF-binding component specifically binding to at least an epitope of VEGF, wherein the components are linked to each other in such a way that they simultaneously bind to Ang2 and VEGF or that they bind to either Ang2 or VEGF at a time. 5 WO 2012/131078 PCT/EP2012/055901 According to preferred aspects of the invention, the two components comprise one or more immunoglobulin single variable domains that may be, independently of each other, VHHs or domain antibodies, and/or any other sort of immunoglobulin single variable domains, such as VL domains, as defined herein, provided that each of these 5 immunoglobulin single variable domains will bind the antigen, i.e. Ang2 or VEGF, respectively. According to a preferred embodiment, the immunoglobulin single variable domains are of the same type, in particular, all immunoglobulin single variable domains are VHHs or domain antibodies. 10 According to a particularly preferred embodiment, all immunoglobulin single variable domains are VHHs, preferably humanized (or "sequence-optimized", as defined herein) VHHs. Accordingly, the invention relates to bispecific binding molecules comprising an (optionally humanized or sequence-optimized) anti-Ang2 VHH and an (optionally humanized or sequence-optimized) anti-VEGF VHH. is However, it will be clear to the skilled person that the teaching herein may be applied analogously to bispecific binding molecules including other anti-Ang2 or anti-VEGF immunoglobulin single variable domains, such as domain antibodies. In another aspect, the invention relates to nucleic acids encoding the bispecific binding molecules of the invention as well as host cells containing same. 20 The invention further relates to a product or composition containing or comprising at least one bispecific binding molecule of the invention and optionally one or more further components of such compositions. The invention further relates to methods for preparing or generating the bispecific binding molecules, nucleic acids, host cells, products and compositions described 25 herein. The invention further relates to applications and uses of the bispecific binding molecules, nucleic acids, host cells, products and compositions described herein, as well as to methods for the prevention and/or treatment for diseases and disorders that can be modulated by inhibition of Ang2. 6 WO 2012/131078 PCT/EP2012/055901 It has been found that the Ang2-binding component of the bispecific binding molecules according to the present invention binds to and antagonizes Ang2 with a potency at least 5,000 times higher, preferably 10,000 times higher than to Ang1 or Ang4. This will largely avoid blocking activation of Ang1-mediated signalling, which would counter the 5 intended anti-angiogenetic effect. It has further been found that the VEGF-binding component of the bi-specific binding molecules according to the present invention binds to VEGF-A with an affinity of at least 1,000 times higher, preferebly at least 5,000 times higher, more preferably at least 10,000 times higher than to VEGF-B, VEGF-C, VEGF-D or PLGF. Due to the highly 10 preferential binding to VEGF-A the signaling of VEGFR3, which modulates of lymph angiogenesis, is not interfered with. In a preferred embodiment the bispecific binding molecules of the present invention are provided as linked VHH domains. Such molecules are significantly smaller than conventional antibodies and have thus the potential for penetrating into a tumor deeper 15 than such conventional antibodies. This benefit is further accentuated by the specific sequences disclosed herein after being free of glycosylation sites. Further, due to the bispecific nature (VEGF- and Ang2-binding components in one molecule) the tumor penetration of both functionalities will be necessarily equal, which will ensure that the beneficial effects of the combined antagonism of VEGF and Ang2 20 will be provided within the whole depth of penetration of the tumor. This is an advantage over the combination of individual antagonists against these targets, since the depth of penetration of individual antagonists will always vary to some degree. Another advantage of a preferred bispecific binding molecules of the present invention is their increased serum half-like due to a serum albumin binding component such as a 25 serum albumin binding molecule as described herein. These and other aspects, embodiments, advantages and applications of the invention will become clear from the further description hereinbelow. 7 WO 2012/131078 PCT/EP2012/055901 DEFINITIONS Unless indicated or defined otherwise, all terms used have their usual meaning in the art, which will be clear to the skilled person. Reference is for example made to the standard handbooks, such as Sambrook et al, "Molecular Cloning: A Laboratory Manual" 5 (2nd Ed.), Vols. 1-3, Cold Spring Harbor Laboratory Press (1989); Lewin, "Genes IV", Oxford University Press, New York, (1990), and Roitt et al., "Immunology" ( 2 nd Ed.), Gower Medical Publishing, London, New York (1989), as well as to the general background art cited herein; Furthermore, unless indicated otherwise, all methods, steps, techniques and manipulations that are not specifically described in detail can be 10 performed and have been performed in a manner known per se, as will be clear to the skilled person. Reference is for example again made to the standard handbooks, to the general background art referred to above and to the further references cited therein. The term "bispecific binding molecule" refers to a molecule comprising at least one Ang2-binding molecule (or "Ang2-binding component") and at least one VEGF-binding 15 molecule (or "VEGF-binding component"). A bispecific binding molecule may contain more than one Ang2-binding molecule and/or more than one VEGF-binding molecule, i.e. in the case that the bispecific binding molecule contains a biparatopic (as defined below) Ang2-binding molecule and/or a biparatopic VEGF-binding molecule, in the part of the molecule that binds to Ang2 or to VEGF, i.e. in its "Ang2-binding component" (or 20 anti-Ang2 component) or "VEGF-binding component" (or anti-VEGF component), respectively. The word "bispecific" in this context is however not to be construed as to exclude further binding components with binding specificity to molecules other than VEGF and Ang2 from the bispecific binding molecule. Non-limiting examples of such further binding components are binding components binding to serum albumin. 25 Unless indicated otherwise, the terms "immunoglobulin" and "immunoglobulin sequence" - whether used herein to refer to a heavy chain antibody or to a conventional 4-chain antibody - are used as general terms to include both the full-size antibody, the individual chains thereof, as well as all parts, domains or fragments thereof (including but not limited to antigen-binding domains or fragments such as VHH domains or VHNL 30 domains, respectively). In addition, the term "sequence" as used herein (for example in 8 WO 2012/131078 PCT/EP2012/055901 terms like "immunoglobulin sequence", "antibody sequence", "(single) variable domain sequence", "VHH sequence" or "protein sequence"), should generally be understood to include both the relevant amino acid sequence as well as nucleic acid sequences or nucleotide sequences encoding the same, unless the context requires a more limited 5 interpretation. The term "domain" (of a polypeptide or protein) as used herein refers to a folded protein structure which has the ability to retain its tertiary structure independently of the rest of the protein. Generally, domains are responsible for discrete functional properties of proteins, and in many cases may be added, removed or transferred to other proteins 10 without loss of function of the remainder of the protein and/or of the domain. The term "immunoglobulin domain" as used herein refers to a globular region of an antibody chain (such as e.g. a chain of a conventional 4-chain antibody or of a heavy chain antibody), or to a polypeptide that essentially consists of such a globular region. Immunoglobulin domains are characterized in that they retain the immunoglobulin fold 15 characteristic of antibody molecules, which consists of a 2-layer sandwich of about 7 antiparallel beta-strands arranged in two beta-sheets, optionally stabilized by a conserved disulphide bond. An immunoglobulin domain comprises (a) variable domain(s), i.e., one or more immunoglobulin variable domains. The term "immunoglobulin variable domain" as used herein means an immunoglobulin 20 domain essentially consisting of four "framework regions" which are referred to in the art and hereinbelow as "framework region 1" or "FR1"; as "framework region 2" or"FR2"; as "framework region 3" or "FR3"; and as "framework region 4" or "FR4", respectively; which framework regions are interrupted by three "complementarity determining regions" or "CDRs", which are referred to in the art and hereinbelow as "complementarity 25 determining region 1"or "CDR1"; as "complementarity determining region 2" or "CDR2"; and as "complementarity determining region 3" or "CDR3", respectively. Thus, the general structure or sequence of an immunoglobulin variable domain can be indicated as follows: FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4. It is the immunoglobulin variable domain(s) that confer specificity to an antibody for the antigen by carrying the 9 WO 2012/131078 PCT/EP2012/055901 antigen-binding site. In the context of the present invention immunoglobulin single variable domains like VHHs and domain antibodies are preferred. The term "immunoglobulin single variable domain" as used herein means an immunoglobulin variable domain which is capable of specifically binding to an epitope of 5 the antigen without pairing with an additional variable immunoglobulin domain. One example of immunoglobulin single variable domains in the meaning of the present invention are "domain antibodies", such as the immunoglobulin single variable domains VH and VL (VH domains and VL domains). Another example of immunoglobulin single variable domains are "VHH domains" (or simply "VHHs") from camelids, as defined 10 hereinafter. In view of the above definition, the antigen-binding domain of a conventional 4-chain antibody (such as an IgG, IgM, IgA, IgD or IgE molecule; known in the art) or of a Fab fragment, a F(ab')2 fragment, an Fv fragment such as a disulphide linked Fv or a scFv fragment, or a diabody (all known in the art) derived from such conventional 4-chain 15 antibody, would normally not be regarded as an immunoglobulin single variable domain, as, in these cases, binding to the respective epitope of an antigen would normally not occur by one (single) immunoglobulin domain but by a pair of (associating) immunoglobulin domains such as light and heavy chain variable domains, i.e. by a VH VL pair of immunoglobulin domains, which jointly bind to an epitope of the respective 20 antigen. "VHH domains", also known as VHHs, VHH domains, VHH antibody fragments, and VHH antibodies, have originally been described as the antigen binding immunoglobulin (variable) domain of "heavy chain antibodies" (i.e. of "antibodies devoid of light chains"; Hamers-Casterman C, Atarhouch T, Muyldermans S, Robinson G, Hamers C, Songa 25 EB, Bendahman N, Hamers R.: "Naturally occurring antibodies devoid of light chains"; Nature 363, 446-448 (1993)). The term "VHH domain" has been chosen in order to distinguish these variable domains from the heavy chain variable domains that are present in conventional 4-chain antibodies (which are referred to herein as "VH domains" or "VH domains") and from the light chain variable domains that are present in 30 conventional 4-chain antibodies (which are referred to herein as "VL domains" or 10 WO 2012/131078 PCT/EP2012/055901 "VL domains"). VHH domains can specifically bind to an epitope without an additional antigen binding domain (as opposed to VH or VL domains in a conventional 4-chain antibody, in which case the epitope is recognized by a VL domain together with a VH domain). VHH domains are small, robust and efficient antigen recognition units formed 5 by a single immunoglobulin domain. In the context of the present invention, the terms VHH domain, VHH, VHH domain, VHH antibody fragment, VHH antibody, as well as "Nanobody@" and "Nanobody@ domain" ("Nanobody" being a trademark of the company Ablynx N.V.; Ghent; Belgium) are used interchangeably and are representatives of immunoglobulin single variable domains 10 (having the structure FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 and specifically binding to an epitope without requiring the presence of a second immunoglobulin variable domain), and which are distinguished from VH domains by the so-called "hallmark residues", as defined in e.g. W02009/109635, Fig. 1. The amino acid residues of a immunoglobulin single variable domain, e.g. a VHH, are 15 numbered according to the general numbering for VH domains given by Kabat et al. ("Sequence of proteins of immunological interest", US Public Health Services, NIH Bethesda, MD, Publication No. 91), as applied to VHH domains from Camelids, as shown e.g. in Figure 2 of Riechmann and Muyldermans, J. Immunol. Methods 231, 25-38 (1999). According to this numbering 20 - FR1 comprises the amino acid residues at positions 1-30, - CDR1 comprises the amino acid residues at positions 31-35, - FR2 comprises the amino acids at positions 36-49, - CDR2 comprises the amino acid residues at positions 50-65, - FR3 comprises the amino acid residues at positions 66-94, 25 - CDR3 comprises the amino acid residues at positions 95-102, and - FR4 comprises the amino acid residues at positions 103-113. However, it should be noted that - as is well known in the art for VH domains and for VHH domains - the total number of amino acid residues in each of the CDRs may vary and may not correspond to the total number of amino acid residues indicated by the 30 Kabat numbering (that is, one or more positions according to the Kabat numbering may 11 WO 2012/131078 PCT/EP2012/055901 not be occupied in the actual sequence, or the actual sequence may contain more amino acid residues than the number allowed for by the Kabat numbering). This means that, generally, the numbering according to Kabat may or may not correspond to the actual numbering of the amino acid residues in the actual sequence. 5 Alternative methods for numbering the amino acid residues of VH domains, which methods can also be applied in an analogous manner to VHH domains, are known in the art. However, in the present description, claims and figures, the numbering according to Kabat and applied to VHH domains as described above will be followed, unless indicated otherwise. 10 The total number of amino acid residues in a VHH domain will usually be in the range of from 110 to 120, often between 112 and 115. It should however be noted that smaller and longer sequences may also be suitable for the purposes described herein. Immunoglobulin single variable domains, e.g. VHHs and domain antibodies, according to the preferred embodiments of the invention, have a number of unique structural 15 characteristics and functional properties which makes them highly advantageous for use in therapy as functional antigen-binding molecules. In particular, and without being limited thereto, VHH domains (which have been "designed" by nature to functionally bind to an antigen without pairing with a light chain variable domain) can function as single, relatively small, functional antigen-binding structural units. 20 Due to their unique properties, immunoglobulin single variable domains, as defined herein, like VHHs or VHs (or VLs) - either alone or as part of a larger polypeptide, e.g. a biparatopic molecule - offer a number of significant advantages: * only a single domain is required to bind an antigen with high affinity and with high selectivity, so that there is no need to have two separate domains present, nor to 25 assure that these two domains are present in the right spacial conformation and configuration (i.e. through the use of especially designed linkers, as with scFv's); * immunoglobulin single variable domains can be expressed from a single nucleic acid molecule and do not require any post-translational modification (like glycosylation; 12 WO 2012/131078 PCT/EP2012/055901 * immunoglobulin single variable domains can easily be engineered into multivalent and multispecific formats (as further discussed herein); * immunoglobulin single variable domains have high specificity and affinity for their target, low inherent toxicity and can be administered via alternative routes than 5 infusion or injection; * immunoglobulin single variable domains are highly stable to heat, pH, proteases and other denaturing agents or conditions and, thus, may be prepared, stored or transported without the use of refrigeration equipments; * immunoglobulin single variable domains are easy and relatively inexpensive to 10 prepare, both on small scale and on a manufacturing scale. For example, immunoglobulin single variable domains can be produced using microbial fermentation (e.g. as further described below) and do not require the use of mammalian expression systems, as with for example conventional antibodies; * immunoglobulin single variable domains are relatively small (approximately 15 15 kDa, or 10 times smaller than a conventional IgG) compared to conventional 4-chain antibodies and antigen-binding fragments thereof, and therefore show high(er) penetration into tissues (including but not limited to solid tumors and other dense tissues) and can be administered in higher doses than such conventional 4-chain antibodies and antigen-binding fragments thereof; 20 * VHHs have specific so-called "cavity-binding properties" (inter alia due to their extended CDR3 loop, compared to VH domains from 4-chain antibodies) and can therefore also access targets and epitopes not accessible to conventional 4-chain antibodies and antigen-binding fragments thereof; * VHHs have the particular advantage that they are highly soluble and very stable 25 and do not have a tendency to aggregate (as with the mouse-derived antigen binding domains described by Ward et al., Nature 341: 544-546 (1989)). 13 WO 2012/131078 PCT/EP2012/055901 The immunoglobulin single variable domains of the invention are not limited with respect to a specific biological source from which they have been obtained or to a specific method of preparation. For example, obtaining VHHs may include the following steps: (1) isolating the VHH domain of a naturally occurring heavy chain antibody; or screening 5 a library comprising heavy chain antibodies or VHHs and isolating VHHs therefrom; (2) expressing a nucleic acid molecule encoding a VHH with the naturally occurring sequence; (3) "humanizing" (as described herein) a VHH, optionally after affinity maturation, with a naturally occurring sequence or expressing a nucleic acid encoding such humanized 10 VHH; (4) "camelizing" (as described below) a immunoglobulin single variable heavy domain from a naturally occurring antibody from an animal species, in particular a species of mammal, such as from a human being, or expressing a nucleic acid molecule encoding such camelized domain; 15 (5) "camelizing" a VH, or expressing a nucleic acid molecule encoding such a camelized VH; (6) using techniques for preparing synthetically or semi-synthetically proteins, polypeptides or other amino acid sequences; (7) preparing a nucleic acid molecule encoding a VHH domain using techniques for 20 nucleic acid synthesis, followed by expression of the nucleic acid thus obtained; (8) subjecting heavy chain antibodies or VHHs to affinity maturation, to mutagenesis (e.g. random mutagenesis or site-directed mutagenesis) and/or any other technique(s) in order to increase the affinity and/or specificity of the VHH; and/or (9) combinations or selections of the foregoing steps. 25 Suitable methods and techniques for performing the above-described steps are known in the art and will be clear to the skilled person. By way of example, methods of 14 WO 2012/131078 PCT/EP2012/055901 obtaining VHH domains binding to a specific antigen or epitope have been described in W02006/040153 and W02006/122786. According to specific embodiments, the immunoglobulin single variable domains of the invention or present in the polypeptides of the invention are VHH domains with an amino 5 acid sequence that essentially corresponds to the amino acid sequence of a naturally occurring VHH domain, but that has been "humanized" or "sequence-optimized" (optionally after affinity-maturation), i.e. by replacing one or more amino acid residues in the amino acid sequence of said naturally occurring VHH sequence by one or more of the amino acid residues that occur at the corresponding position(s) in a variable heavy 10 domain of a conventional 4-chain antibody from a human being. This can be performed using methods known in the art, which can by routinely used by the skilled person. A humanized VHH domain may contain one or more fully human framework region sequences, and, in an even more specific embodiment, may contain human framework region sequences derived from the human germline Vh3 sequences DP-29, DP-47, 15 DP-51, or parts thereof, or be highly homologous thereto, optionally combined with JH sequences, such as JH5. Thus, a humanization protocol may comprise the replacement of any of the VHH residues with the corresponding framework 1, 2 and 3 (FRI, FR2 and FR3) residues of germline VH genes such as DP 47, DP 29 and DP 51) either alone or in combination. Suitable framework regions (FR) of the immunoglobulin single variable 20 domains of the invention can be selected from those as set out e.g. in W02006/004678 and specifically, include the so-called "KERE" and "GLEW" classes. Examples are immunoglobulin single variable domains having the amino acid sequence G-L-E-W at about positions 44 to 47, and their respective humanized counterparts. A humanized VHH domain may contain one or more fully human framework region sequences. 25 By way of example, a humanizing substitution for VHHs belonging to the 103 P,R,S group and/or the GLEW-group (as defined below) is 108Q to 108L. Methods for humanizing immunoglobulin single variable domains are known in the art. Binding immunoglobulin single variable domains with improved properties in view of therapeutic application, e.g. enhanced affinity or decreased immunogenicity, may be 30 obtained from individual binding molecules by techniques known in the art, such as 15 WO 2012/131078 PCT/EP2012/055901 affinity maturation (for example, starting from synthetic, random or naturally occurring immunoglobulin sequences), CDR grafting, humanizing, combining fragments derived from different immunoglobulin sequences, PCR assembly using overlapping primers, and similar techniques for engineering immunoglobulin sequences well known to the 5 skilled person; or any suitable combination of any of the foregoing, also termed "sequence optimization", as described herein. Reference is, for example, made to standard handbooks, as well as to the further description and Examples. If appropriate, a binding molecule with increased affinity may be obtained by affinity maturation of another binding molecule, the latter representing, with respect to the 10 affinity-matured molecule, the "parent" binding molecule. Methods of obtaining VHHs that bind to a specific antigen or epitope have been described earlier, e.g. in W02006/040153 and W02006/122786. As also described therein in detail, VHH domains derived from camelids can be "humanized" (also termed "sequence-optimized" herein, "sequence-optimizing" may, in addition to humanization, 15 encompass an additional modification of the sequence by one or more mutations that furnish the VHH with improved properties, such as the removal of potential post translational modification sites) by replacing one or more amino acid residues in the amino acid sequence of the original VHH sequence by one or more of the amino acid residues that occur at the corresponding position(s) in a VH domain from a conventional 20 4-chain antibody from a human being. A humanized VHH domain can contain one or more fully human framework region sequences, and, in an even more specific embodiment, can contain human framework region sequences derived from DP-29, DP-47, DP-51, or parts thereof, optionally combined with JH sequences, such as JH5. Domain antibodies, also known as "Dab"s and "dAbs" (the terms "Domain Antibodies" 25 and "dAbs" being used as trademarks by the GlaxoSmithKline group of companies) have been described in e.g. Ward, E.S., et al.: "Binding activities of a repertoire of single immunoglobulin variable domains secreted from Escherichia coli"; Nature 341: 544-546 (1989); Holt, L.J. et al.: "Domain antibodies: proteins for therapy"; TRENDS in Biotechnology 21(11): 484-490 (2003); and W02003/002609. 16 WO 2012/131078 PCT/EP2012/055901 Domain antibodies essentially correspond to the VH or VL domains of antibodies from non-camelid mammals, in particular human 4-chain antibodies. In order to bind an epitope as a single antigen binding domain, i.e. without being paired with a VL or VH domain, respectively, specific selection for such antigen binding properties is required, 5 e.g. by using libraries of human single VH or VL domain sequences. Domain antibodies have, like VHHs, a molecular weight of approximately 13 to approximately 16 kDa and, if derived from fully human sequences, do not require humanization for e.g. therapeutical use in humans. As in the case of VHH domains, they are well expressed also in prokaryotic expression systems, providing a significant 10 reduction in overall manufacturing cost. Furthermore, it will also be clear to the skilled person that it is possible to "graft" one or more of the CDR's mentioned above onto other "scaffolds", including but not limited to human scaffolds or non-immunoglobulin scaffolds. Suitable scaffolds and techniques for such CDR grafting are known in the art. is The terms "epitope" and "antigenic determinant", which can be used interchangeably, refer to the part of a macromolecule, such as a polypeptide, that is recognized by antigen-binding molecules, such as conventional antibodies or the polypeptides of the invention, and more particularly by the antigen-binding site of said molecules. Epitopes define the minimum binding site for an immunoglobulin, and thus represent the target of 20 specificity of an immunoglobulin. A polypeptide (such as an immunoglobulin, an antibody, an immunoglobulin single variable domain of the invention, or generally an antigen-binding molecule or a fragment thereof) that can "bind to" or "specifically bind to", that "has affinity fo' and/or that "has specificity fo' a certain epitope, antigen or protein (or for at least one part, fragment or 25 epitope thereof) is said to be "against" or "directed against" said epitope, antigen or protein or is a "binding" molecule with respect to such epitope, antigen or protein. In this context, a VEGF-binding component may also be referred to as "VEGF-neutralizing". Generally, the term "specificity' refers to the number of different types of antigens or epitopes to which a particular antigen-binding molecule or antigen-binding protein (such 30 as an immunoglobulin single variable domain of the invention) molecule can bind. The 17 WO 2012/131078 PCT/EP2012/055901 specificity of an antigen-binding molecule can be determined based on its affinity and/or avidity. The affinity, represented by the equilibrium constant for the dissociation of an antigen with an antigen-binding protein (KD), is a measure for the binding strength between an epitope and an antigen-binding site on the antigen-binding protein: the 5 lesser the value of the KD, the stronger the binding strength between an epitope and the antigen-binding molecule (alternatively, the affinity can also be expressed as the affinity constant (KA), which is 1/KD). As will be clear to the skilled person (for example on the basis of the further disclosure herein), affinity can be determined in a manner known per se, depending on the specific antigen of interest. Avidity is the measure of the strength 10 of binding between an antigen-binding molecule (such as an immunoglobulin, an antibody, an immunoglobulin single variable domain or a polypeptides containing it and the pertinent antigen. Avidity is related to both the affinity between an epitope and its antigen binding site on the antigen-binding molecule and the number of pertinent binding sites present on the antigen-binding molecule. 15 The part of an antigen-binding molecule that recognizes the epitope is called a paratope. Unless indicated otherwise, the term "VEGF-binding molecule" or "Ang2-binding molecule" includes anti-VEGF or anti-Ang2 antibodies, anti-VEGF antibody or anti-Ang2 antibody fragments, "anti-VEGF antibody-like molecules" or "anti-Ang2 antibody-like molecules", as defined herein, and conjugates with any of these. Antibodies include, but 20 are not limited to, monoclonal and chimerized monoclonal antibodies. The term ,,antibody" encompasses complete immunoglobulins, like monoclonal antibodies produced by recombinant expression in host cells, as well as antibody fragments or "antibody-like molecules", including single-chain antibodies and linear antibodies, so called "SMIPs" ("Small Modular Immunopharmaceuticals"), as e.g described in 25 W02002/056910; Antibody-like molecules include immunoglobulin single variable domains, as defined herein. Other examples for antibody-like molecules are immunoglobulin super family antibodies (IgSF), or CDR-grafted molecules. "Ang2-binding molecule" or "VEGF-binding molecule" respectively, refers to both monovalent target-binding molecules (i.e. molecules that bind to one epitope of the 30 respective target) as well as to bi- or multivalent binding molecules (i.e. binding 18 WO 2012/131078 PCT/EP2012/055901 molecules that bind to more than one epitope, e.g. "biparatopic" molecules as defined hereinbelow). Ang2(or VEGF)-binding molecules containing more than one Ang2(or VEGF)-binding immunoglobulin single variable domain are also termed "formatted" binding molecules, they may, within the target-binding component, in addition to the 5 immunoglobulin single variable domains, comprise linkers and/or moieties with effector functions, e.g. half-life-extending moieties like albumin-binding immunoglobulin single variable domains, and/or a fusion partner like serum albumin and/or an attached polymer like PEG. The term "biparatopic Ang2(or VEGF)-binding molecule" or "biparatopic immunoglobulin 10 single variable domain" as used herein shall mean a binding molecule comprising a first immunoglobulin single variable domain and a second immunoglobulin single variable domain as herein defined, wherein the two molecules bind to two non-overlapping epitopes of the respective antigen. The biparatopic binding molecules are composed of immunoglobulin single variable domains which have different specificities with respect to 15 the epitope. The part of an antigen-binding molecule (such as an antibody or an immunoglobulin single variable domain of the invention) that recognizes the epitope is called a paratope. A formatted binding molecule may, albeit less preferred, also comprise two identical immunoglobulin single variable domains or two different immunoglobulin single variable 20 domains that recognize the same or overlapping epitopes or their respective antigen. In this case, with respect to VEGF, the two immunoglobulin single variable domains may bind to the same or an overlapping epitope in each of the two monomers that form the VEGF dimer. Typically, the binding molecules of the invention will bind with a dissociation constant 25 (KD) of 1OE-5 to 1OE-14 moles/liter (M) or less, and preferably 1OE-7 to 1OE-14 moles/liter (M) or less, more preferably 1OE-8 to 1OE-14 moles/liter, and even more preferably 1 OE-1 1 to 1 OE-1 3, as measured e.g. in a Biacore or in a Kinexa assay), and/or with an association constant (KA) of at least 1 0E7 ME-1, preferably at least 1 0E8 ME-1, more preferably at least 1 0E9 ME-1, such as at least 1 OE11 ME-1. Any KD value 30 greater than 1 OE-4 M is generally considered to indicate non-specific binding. 19 WO 2012/131078 PCT/EP2012/055901 Preferably, a polypeptide of the invention will bind to the desired antigen, i.e. VEGF or Ang2, respectively, with a KD less than 500 nM, preferably less than 200 nM, more preferably less than 10 nM, such as less than 500 pM. Specific binding of an antigen binding protein to an antigen or epitope can be determined in any suitable manner 5 known per se, including, for example, the assays described herein, Scatchard analysis and/or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA) and sandwich competition assays, and the different variants thereof known per se in the art. Amino acid residues will be indicated according to the standard three-letter or one-letter 10 amino acid code, as generally known and agreed upon in the art. When comparing two amino acid sequences, the term "amino acid difference" refers to insertions, deletions or substitutions of the indicated number of amino acid residues at a position of the reference sequence, compared to a second sequence. In case of substitution(s), such substitution(s) will preferably be conservative amino acid substitution(s), which means 15 that an amino acid residue is replaced with another amino acid residue of similar chemical structure and which has little or essentially no influence on the function, activity or other biological properties of the polypeptide. Such conservative amino acid substitutions are well known in the art, for example from W01998/49185, wherein conservative amino acid substitutions preferably are substitutions in which one amino 20 acid within the following groups (i) - (v) is substituted by another amino acid residue within the same group: (i) small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, Pro and Gly; (ii) polar, negatively charged residues and their (uncharged) amides: Asp, Asn, Glu and Gln; (iii) polar, positively charged residues: His, Arg and Lys; (iv) large aliphatic, nonpolar residues: Met, Leu, Ile, Val and Cys; and (v) aromatic residues: 25 Phe, Tyr and Trp. Particularly preferred conservative amino acid substitutions are as follows: Ala into Gly or into Ser; Arg into Lys; Asn into GIn or into His; Asp into Glu;Cys into Ser; GIn into Asn; Glu into Asp; Gly into Ala or into Pro; His into Asn or into Gln; Ile into Leu or into Val; Leu into Ile or into Val; Lys into Arg, into GIn or into Glu; Met into Leu, into Tyr or into Ile; Phe into Met, into Leu or into Tyr; Ser into Thr; Thr into Ser;Trp 30 into Tyr; Tyr into Trp or into Phe; Val into Ile or into Leu. 20 WO 2012/131078 PCT/EP2012/055901 A polypeptide or nucleic acid molecule is considered to be "(in) essentially isolated (form)" - for example, when compared to its native biological source and/or the reaction medium or cultivation medium from which it has been obtained - when it has been separated from at least one other component with which it is usually associated in said 5 source or medium, such as another protein/polypeptide, another nucleic acid, another biological component or macromolecule or at least one contaminant, impurity or minor component. In particular, a polypeptide or nucleic acid molecule is considered "essentially isolated" when it has been purified at least 2-fold, in particular at least 10 fold, more in particular at least 100-fold, and up to 1000-fold or more. A polypeptide or 10 nucleic acid molecule that is "in essentially isolated form" is preferably essentially homogeneous, as determined using a suitable technique, such as a suitable chromatographical technique, such as polyacrylamide gel electrophoresis. "Sequence identity' between two VEGF-binding molecule sequences or between two Ang2-binding molecule sequences indicates the percentage of amino acids that are 15 identical between the sequences. It may be calculated or determined as described in paragraph f) on pages 49 and 50 of W02008/020079. "Sequence similarity" indicates the percentage of amino acids that either are identical or that represent conservative amino acid substitutions. Alternative methods for numbering the amino acid residues of VH domains, which 20 methods can also be applied in an analogous manner to VHH domains, are known in the art. However, in the present description, claims and figures, the numbering according to Kabat and applied to VHH domains as described above will be followed, unless indicated otherwise. An "affinity-matured" VEGF-binding molecule or Ang2-binding molecule, in particular a 25 VHH or a domain antibody, has one or more alterations in one or more CDRs which result in an improved affinity for VEGF or Ang2, as compared to the respective parent VEGF-binding molecule or Ang2-binding molecule. Afffinity-matured VEGF-binding molecules or Ang2-binding molecules of the invention may be prepared by methods known in the art, for example, as described by Marks et al., 1992, Biotechnology 10: 30 779-783, or Barbas, et al., 1994, Proc. Nat. Acad. Sci, USA 91: 3809-3813.; Shier et al., 21 WO 2012/131078 PCT/EP2012/055901 1995, Gene 169:147-155; Yelton et al., 1995, Immunol. 155: 1994-2004; Jackson et al., 1995, J. Immunol. 154(7):3310-9; and Hawkins eta., 1992, J. Mol. Biol. 226(3): 889 896; KS Johnson and RE Hawkins, "Affinity maturation of antibodies using phage display", Oxford University Press 1996. 5 For the present invention, an "amino acid sequences of SEQ ID NO: x": includes, if not otherwise stated, an amino acid sequence that is 100% identical with the sequence shown in the respective SEQ ID NO: x; a) amino acid sequences that have at least 80% amino acid identity with the sequence shown in the respective SEQ ID NO: x; 10 b) amino acid sequences that have 3, 2, or 1 amino acid differences with the sequence shown in the respective SEQ ID NO: x. The terms "cancer" and "cancerous" refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth/proliferation. Examples of cancer to be treated with a bispecific binding molecule of the invention, 15 include but are not limited to carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers, as suggested for treatment with VEGF antagonists in US 2008/0014196, include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, 20 pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, gastric cancer, melanoma, and various types of head and neck cancer. Dysregulation of angiogenesis can lead to many 25 disorders that can be treated by compositions and methods of the invention. These disorders include both non-neoplastic and neoplastic conditions. Neoplasties include but are not limited those described above. Non-neoplastic disorders include, but are not limited to, as suggested for treatment with VEGF antagonists in US2008/0014196, undesired or aberrant hypertrophy, arthritis, 30 rheumatoid arthritis (RA), psoriasis, psoriatic plaques, sarcoidosis, atherosclerosis, 22 WO 2012/131078 PCT/EP2012/055901 atherosclerotic plaques, diabetic and other proliferative retinopathies including retinopathy of prematurity, retrolental fibroplasia, neovascular glaucoma, age-related macular degeneration, diabetic macular edema, corneal neovascularization, corneal graft neovascularization, corneal graft rejection, retinal/choroidal neovascularization, 5 neovascularization of the angle (rubeosis), ocular neovascular disease, vascular restenosis, arteriovenous malformations (AVM), meningioma, hemangioma, angiofibroma, thyroid hyperplasias (including Grave's disease), corneal and other tissue transplantation, chronic inflammation, lung inflammation, acute lung injury/ ARDS, sepsis, primary pulmonary hypertension, malignant pulmonary effusions, cerebral 10 edema (e.g., associated with acute stroke/ closed head injury/ trauma), synovial inflammation, pannus formation in RA, myositis ossificans, hypertropic bone formation, osteoarthritis (OA), refractory ascites, polycystic ovarian disease, endometriosis, 3 rd spacing of fluid diseases (pancreatitis, compartment syndrome, burns, bowel disease), uterine fibroids, premature labor, chronic inflammation such as IBD (Crohn's disease 15 and ulcerative colitis), renal allograft rejection, inflammatory bowel disease, nephrotic syndrome, undesired or aberrant tissue mass growth (non-cancer), hemophilic joints, hypertrophic scars, inhibition of hair growth, Osier-Weber syndrome, pyogenic granuloma retrolental fibroplasias, scleroderma, trachoma, vascular adhesions, synovitis, dermatitis, preeclampsia, ascites, pericardial effusion (such as that associated 20 with pericarditis), and pleural effusion. DETAILED DESCRIPTION OF THE INVENTION In a first aspect, the present invention relates to a bispecific binding molecule comprising at least one Ang2-binding component and at least one VEGF-binding component. In a preferred embodiment, the present invention relates to a bispecific binding molecule 25 comprising at least one VEGF-binding component and at least one Ang2-binding component which further comprises at least a further binding component, preferably a serum albumin binding component (serum albumin binding molecule). In a preferred embodiment, the serum albumin binding component of the binding molecule of the present invention is an isolated immunoglobulin single variable domain 30 or a polypeptide containing one or more of said immunoglobulin single variable domains, 23 WO 2012/131078 PCT/EP2012/055901 wherein said immunoglobulin single variable domain consists of four framework regions and three complementarity determining regions CDR1, CDR2 and CDR3, respectively, and wherein said CDR3 has an amino acid sequence selected from amino acid sequences shown in SEQ ID NOs: 257, 260, 263, 266, 269, 272, or 275. 5 More preferably, said one or more immunoglobulin single variable domain of the serum albumin binding component contain a. a CDR3 with an amino acid sequence selected from a first group of amino acid sequences shown in SEQ ID NOs: SEQ IDs NOs: 257, 260, 263, 266, 269, 272, or 275; 10 b. a CDR1 with an amino acid sequences selected from a second group of amino acid sequences shown SEQ ID NOs:255, 258, 261, 264, 267, 270, or 273; c. a CDR2 with an amino acid sequences selected from a second group of amino acid sequences shown SEQ ID NOs:256, 259, 262, 265, 268, 271, or 274. In a more preferred embodiment, said one or more immunoglobulin single variable 15 domains of the serum albumin binding component are VHHs, preferably having an amino acid sequence shown in SEQ ID NOs: 98 or 254. According to preferred embodiments, said Ang2-binding component and said VEGF binding component comprise at least one Ang2-binding immunoglobulin single variable 20 domain and at least one VEGF-binding immunoglobulin single variable domain, respectively. In a preferred aspect, said Ang2-binding component and said VEGF-binding component each comprise at least one VEGF-binding immunoglobulin single variable domain and at least one Ang2-binding immunoglobulin single variable domain, respectively, wherein 25 each of said immunoglobulin single variable domains has four framework regions and three complementarity determining regions CDR1, CDR2 and CDR3, respectively. Thus, the anti-Ang2 and/or the anti-VEGF component contained in the bispecific binding molecules of the invention may include two (or more) anti-Ang2 (or anti-VEGF, 24 WO 2012/131078 PCT/EP2012/055901 respectively) immunoglobulin single variable domains, wherein the immunoglobulin single variable domains are directed against different epitopes within the Ang2 (or VEGF) target. Thus, the two immunoglobulin single variable domains in a bispecific binding molecule will have different antigen specificity and therefore different CDR 5 sequences. Such bivalent binding molecules are also named "biparatopic single domain antibody constructs" (if the immunoglobulin single variable domains consist or essentially consist of single domain antibodies), or "biparatopic VHH constructs" (if the immunoglobulin single variable domains consist or essentially consist of VHHs), respectively, as the two 10 immunoglobulin single variable domains will include two different paratopes. In the bispecific binding molecule of the invention, one or both of the binding molecules may be bivalent; e.g. the VEGF-binding component may be biparatopic and the Ang2 binding component may be one immunoglobulin single variable domain, or the VEGF binding component may be one immunoglobulin single variable domain and the Ang2 15 binding component may be biparatopic. In bispecific binding molecules of the invention, it is preferably the VEGF-binding component that contains a bivalent VEGF-binding immunoglobulin single variable domain, e.g. a biparatopic VHH. Such VEGF-binding immunoglobulin single variable domain may be two or more VEGF 20 binding VHHs, which are a. identical VHHs that are capable of blocking the interaction between recombinant human VEGF and the recombinant human VEGFR-2 with an inhibition rate of> 60% or b. different VHHs that bind to non-overlapping epitopes of VEGF, wherein at least 25 one VHH is capable of blocking the interaction between recombinant human VEGF and the recombinant human VEGFR-2 with an inhibition rate of 60% and wherein at least one VHH is capable of blocking said interaction with an inhibition rate of 5 60%. 25 WO 2012/131078 PCT/EP2012/055901 The VEGF-binding component comprising at least a variable domain with four framework regions and three complementarity determining regions CDR1, CDR2 and CDR3, respectively, wherein said CDR3 has the amino acid sequence Ser Arg Ala Tyr Xaa Ser Xaa Arg Leu Arg Leu Xaa Xaa Thr Tyr Xaa Tyr as shown in SEQ ID NO: 1, 5 wherein Xaa at position 5 is Gly or Ala; Xaa at position 7 is Ser or Gly; Xaa at position 12 is Gly, Ala or Pro; Xaa at position 13 is Asp or Gly; 10 Xaa at position 16 is Asp or Glu; and wherein said VEGF-binding component is capable of blocking the interaction of human recombinant VEGF165 with the human recombinant VEGFR-2 with an inhibition rate of 60%. According to preferred embodiments, Xaa at position 5 is Gly, Xaa at position 7 is Ser, 15 Xaa at position 12 is Ala, and Xaa at position 13 is Asp. In particular, said CDR3 has a sequence selected from SEQ ID NO: 2 SRAYGSSRLRLGDTYDY, SEQ ID NO: 3 SRAYGSSRLRLADTYDY; SEQ ID NO: 4 SRAYGSSRLRLADTYEY; 20 SEQ ID NO:5 SRAYGSGRLRLADTYDY; SEQ ID NO: 6 SRAYASSRLRLADTYDY; SEQ ID NO: 7 SRAYGSSRLRLPDTYDY; SEQ ID NO: 8 SRAYGSSRLRLPGTYDY. According to certain embodiments, a VEGF-binding component comprises one or more 25 immunoglobulin single variable domains each containing a. a CDR3 with an amino acid sequence selected from a first group of sequences shown in SEQ ID NO: 2 to 8; b. a CDR1 and a CDR2 with an amino acid sequences that is contained, as indicated in Table 3, in a sequence selected from a second group of amino acid 26 WO 2012/131078 PCT/EP2012/055901 sequences shown in SEQ ID NOs: 9 to 46, wherein said second sequence contains the respective CDR3 selected according to a). According to preferred embodiments, the immunoglobulin single variable domains are VHHs. 5 According to specific embodiments, the VHHs have amino acid sequences selected from sequences shown in SEQ ID NOs: 9 - 46. According to another specific embodiment, the VHHs have amino acid sequences selected from SEQ ID NOs: 15, SEQ ID NO: 18 and SEQ ID NO: 25. The invention also relates to VEGF-binding component that have been obtained by 10 affinity maturation and/or sequence optimization of an above-defined VHH, e.g. to a VHH that has been obtained by sequence optimization of a VHH having an amino acid sequence shown in SEQ ID NO: 18. Examples are VHHs having amino acid sequences selected from sequences shown in SEQ ID NOs: 47 - 57. According to certain embodiments, a VEGF-binding domain of the invention may be 15 formatted, as herein defined, e.g. it may be biparatopic or comprise two identical immunoglobulin single variable domains. Such VEGF-binding components may comprise two or more VHHs, which are a) identical VHHs that are capable of blocking the interaction between recombinant human VEGF and the recombinant human VEGFR-2 with an 20 inhibition rate of 60% or b) different VHHs that bind to non-overlapping epitopes of VEGF, wherein at least one VHH is capable of blocking the interaction between recombinant human VEGF and the recombinant human VEGFR-2 with an inhibition rate of 60% and wherein at least one VHH binds is capable of blocking said 25 interaction with an inhibition rate of 5 60 %. The percentage of blocking said interaction at an inhibition rate of 60% or < 60 %, respectively, refers to an inhibition rate as determined by an Amplified Luminescent 27 WO 2012/131078 PCT/EP2012/055901 Proximity Homogeneous Assay (AlphaScreen*), a competition ELISA, a plasmon resonance (SPR) based assay (Biacore*) as used in the Examples. In the following, the ability of VHHs according to a) is also termed "receptor-blocking", while the ability of VHHs according to b) is also termed "non-receptor-blocking". 5 Preferably, the receptor-blocking VHHs have an inhibition rate of > 80%, more preferably > 90%, the most preferred VHHs being complete receptor blockers, i.e. have an inhibition rate of 100 %. A VEGF-binding component may contain two or more identical VHHs a) selected from VHHs having amino acid sequences shown in SEQ ID NOs: 9 - 46 or VHHs that have 10 been obtained by affinity maturation and/or sequence optimization of such VHH. The VHH may be selected from VHHs having the amino acid shown in SEQ ID NO: 18 or SEQ ID NO: 47 - 57. According to preferred embodiments, a formatted VEGF-binding component comprises two VHHs each having the amino acid sequence shown in SEQ ID NO: 57. 15 In formatted VEGF-binding components comprising two different VHHs a) said one or more VHHs with an inhibition rate of 60% are selected from i. VHHs having an amino acid sequence selected from amino acid sequences shown in SEQ ID NOs: 9 - 46 or ii. VHHs that have been obtained by affinity maturation and/or 20 sequence optimization of such VHHs, and wherein b) said one or more VHHs with an inhibition rate of 5 60 % are selected from i. SEQ ID NOs: 58 - 124 or ii. VHHs that have been obtained by affinity maturation and/or sequence optimization of such VHH. 28 WO 2012/131078 PCT/EP2012/055901 According to preferred embodiments, two VHHs are contained in polypeptides with amino acid sequences shown in SEQ ID NOs: 128 - 168, separated by linker sequences as indicated in Table 15. In a preferred VEGF-binding component VHH a) i. has an amino acid sequence shown 5 in SEQ ID NO: 18 and VHH b) i. has an amino acid sequence shown in SEQ ID NO: 64. In other preferred VEGF-binding components VHHs according to a) ii. are selected from VHHs having an amino acid sequence shown in SEQ ID NOs: 47 - 57 and VHHs according to b) ii. are selected from VHHs having an amino acid sequence shown in SEQ ID NOs: 125 - 127. 10 Particularly preferred is a biparatopic VEGF-binding component comprising two VHHs, one of them having the amino acid shown in SEQ ID NO: 57 and one of them having the amino acid shown in SEQ ID NO: 127. The Ang2-binding component comprises at least a variable domain with four framework regions and three complementarity determining regions CDR1, CDR2 and CDR3, 15 respectively, wherein said CDR3 has an amino acid sequence selected from amino acid sequences shown in SEQ ID NOs: 226, 229, 232, 235, 238, 241, 244, 247, 250, or 253. In a second aspect, said Ang2-binding component is an isolated immunoglobulin single variable domain or a polypeptide containing one or more of said immunoglobulin single variable domains, wherein said immunoglobulin single variable domain consists of four 20 framework regions and three complementarity determining regions CDR1, CDR2 and CDR3, respectively, and wherein said CDR3 has an amino acid sequence selected from amino acid sequences shown in SEQ ID NOs: 226, 229, 232, 235, 238, 241, 244, 247, 250, or 253. In a further aspect, said immunoglobulin single variable domain of the Ang2-binding 25 component contains a. a CDR3 with an amino acid sequence selected from a first group of amino acid sequences shown in SEQ ID NOs: SEQ IDs NOs: 226, 229, 232, 235, 238, 241, 244, 247, 250, or 253 (see also Table 49); 29 WO 2012/131078 PCT/EP2012/055901 b. a CDR1 with an amino acid sequences that is contained, as indicated in Table 36-A, 38-A, 41-A, or 45-A, as partial sequence in a sequence selected from a second group of amino acid sequences shown SEQ ID NOs: 224, 227, 230, 233, 236, 239, 242, 245, 248, or 251 (see also Table 49); 5 c. a CDR2 with an amino acid sequences that is contained, as indicated in Table 36-A, 38-A, 41-A, or 45-A, as partial sequence in a sequence selected from a second group of amino acid sequences shown SEQ ID NOs: 225, 228, 231, 234, 237, 240, 243, 246, 249, or 252 (see also Table 49). Preferably, the immunoglobulin single variable domain of the Ang2-binding component is 10 a VHH, preferably having amino acid sequence selected from amino acid sequences shown in SEQ ID NOs: 214, 215, 216, 217, 218, 219, 220, 221, 222, or 223. In another preferred embodiment, the immunoglobulin single variable domain of the Ang2-binding component has been obtained by affinity maturation or humanization of an immunoglobulin single variable domain as described herein. 15 Similarly, the present invention also relates to a VHH which has been obtained by affinity maturation or humanization of a VHH of the Ang2-binding component as described herein. The present invention thus also relates to an Ang2-binding VHH with an amino acid sequence selected from acid sequences shown in SEQ ID NOs: 214, 215, 216, 217, 20 218, 219, 220, 221, 222, or 223. Suitable parent Ang2-binding components for affinity maturation are, by way of example, the above-described VHHs with amino acid sequences shown in SEQ ID NOs:214, 215, 216, 217, 21i8, or 219. 25 Accordingly, the invention also relates to Ang2-binding molecules that have been obtained by affinity maturation and/or sequence optimization of an above-defined VHH, e.g. to a VHH that has been obtained by sequence optimization of a VHH having an amino acid sequence shown as SEQ ID NOs: 217, 218, 219, 220, 221, 222, or 223. The 30 WO 2012/131078 PCT/EP2012/055901 "source" amino acid sequences that were used to generate the latter VHHs are shown in SEQ ID NOs: 214, 215, or 216. Also these amino acid sequences are suitable Ang2 binding components that can be applied in the binding molecules of the present invention. 5 As described herein, the binding molecule of the present invention preferably comprises at least one serum albumin binding component. Particularly preferred binding molecules thus have at least one VEGF-binding component, at least one Ang2-binding component and at least one serum albumin binding component. The order of these three binding components could be any possible order such as the order set out in Table 36-B, 38-B, 10 40, 41-B, 42, 43, 45-B, 46-A, or 47-A; or in Figure 20, 23, 27, or 30, e.g. the VEGF-, Ang2-or serum albumin binding component can be N-terminal or C-terminal. Notably, "ID01" (SEQ ID No: 214), "11B07", "00027" (SEQ ID No:216), "00908", "7G08" (SEQ ID No:215), "00919", "00921" (SEQ ID No: 220), "00928" (SEQ ID No:221), "00932", "00933", "00934", "00935", "00936", "00937", "00938" (SEQ ID No:222), or "00956" (SEQ 15 ID No:223) as referred to in the legend of the aforementioned Tables and Figures stand for Ang2-binding components, while "00038" stands for a VEGF-binding component and "ALB1 1" stands for a serum albumin binding component. None of them is to be construed to a specific sequence, but stands for a Ang2-, VEGF- and serum albumin binding component in general when used in the context of possible set-ups of binding 20 molecules of the present invention. However, it is preferred that the serum albumin binding component is in between the VEGF- and Ang2-binding component (or vice versa), while it is particularly preferred that at least one VEGF-binding component is N-terminal, followed by at least one serum albumin binding component, followed by at least one Ang2-binding component at the 25 C-Terminus. This set-up is shown to be specifically useful. The present invention relates thus in a preferred aspect to binding molecules comprising at least one VEGF-binding component, at least one Ang2-binding component and at least one serum albumin binding component having an amino acid sequence selected from the amino acid sequences shown in SEQ ID NOs: 180-213, 31 WO 2012/131078 PCT/EP2012/055901 "At least one" binding component (VEGF, Ang2 or serum albumin) when used herein includes that a binding molecule of the present invention may contain one, two, three, four or five VEGF-, Ang2-, and/or serum albumin binding components (i.e., entities/units) which are preferably represented by an immunoglobulin singly variable domain as 5 described herein. The VEGF- and/or Ang2-binding components with improved properties in view of therapeutic application, e.g. enhanced affinity or decreased immunogenicity, may be obtained from individual VEGF-or Ang2-binding components of the invention by techniques known in the art, such as affinity maturation (for example, starting from 10 synthetic, random or naturally occurring immunoglobulin sequences), CDR grafting, humanizing, combining fragments derived from different immunoglobulin sequences, PCR assembly using overlapping primers, and similar techniques for engineering immunoglobulin sequences well known to the skilled person; or any suitable combination of any of the foregoing, also termed "sequence optimization", as described herein. 15 Reference is, for example, made to standard handbooks, as well as to the further description and Examples. If appropriate, a VEGF-or Ang2-binding component of the invention with increased affinity may be obtained by affinity-maturation of another VEGF-or Ang2-binding component, the latter representing, with respect to the affinity-matured molecule, the 20 "parent" VEGF-binding component. In VEGF or Ang2 VHHs of the invention that start with EVQ, the N-terminal E may be replaced by a D (which is often a result of sequence-optimization) or it may be missing (as for expression of the VHH in E.coli). For formatted VEGF-binding components, this usually applies only to the VHH that is situated N-terminally. 25 A preferred, but non-limiting humanizing substitution for VEGF VHH domains belonging to the 103 P,R,S-group and/or the GLEW-group (as defined below) is 108Q to 108L. Methods for humanizing immunoglobulin single variable domains are known in the art. According to another embodiment, the immunoglobulin single variable domain is a domain antibody, as defined herein. 32 WO 2012/131078 PCT/EP2012/055901 In yet another embodiment, the representatives of the class of VEGF-and/or Ang2 binding immunoglobulin single variable domains of the invention have amino acid sequences that correspond to the amino acid sequence of a naturally occurring VH domain that has been "camelized", i.e. by replacing one or more amino acid residues in 5 the amino acid sequence of a naturally occurring variable heavy chain from a conventional 4-chain antibody by one or more amino acid residues that occur at the corresponding position(s) in a VHH domain of a heavy chain antibody. This can be performed in a manner known per se, which will be clear to the skilled person, and reference is additionally be made to W01994/04678. Such camelization may 10 preferentially occur at amino acid positions which are present at the VH-VL interface and at the so-called Camelidae Hallmark residues (see for example also W01994/04678). A detailled description of such "humanization" and "camelization" techniques and preferred framework region sequences consistent therewith can additionally be taken from e.g. pp. 46 and pp. 98 of W02006/040153 and pp. 107 of W02006/122786. 15 The VEGF-binding components of the invention, e.g. immunoglobulin single variable domains, have specificity for VEGF in that they comprise one or more immunoglobulin single variable domains specifically binding to one or more epitopes within the VEGF molecule. The same is true for Ang2-binding components of the invention. Specific binding of an VEGF-binding component to its antigen VEGF can be determined 20 in any suitable manner known per se, including, for example, the assays described herein, Scatchard analysis and/or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA and ELISA) and sandwich competition assays, and the different variants thereof known per se in the art. The same is true for an Ang2-binding component when binding to its antigen. 25 With regard to the antigen VEGF, a VEGF-binding component of the invention, e.g. an immunoglobulin single variable domain, is not limited with regard to the species. Thus, the immunoglobulin single variable domains of the invention preferably bind to human VEGF, if intended for therapeutic purposes in humans. However, immunoglobulin single variable domains that bind to VEGF from another mammalian species are also within the 30 scope of the invention. An immunoglobulin single variable domain of the invention 33 WO 2012/131078 PCT/EP2012/055901 binding to one species form of VEGF may cross-react with VEGF, which has a different sequence than the human one, from one or more other species. For example, immunoglobulin single variable domains of the invention binding to human VEGF may exhibit cross reactivity with VEGF from one or more other species of primates and/or 5 with VEGF from one or more species of animals that are used in animal models for diseases, for example monkey, mouse, rat, rabbit, pig, dog, and in particular in animal models for diseases and disorders associated with VEGF-mediated effects on angiogenesis (such as the species and animal models mentioned herein). Immunoglobulin single variable domains of the invention that show such cross-reactivity 10 are advantageous in a research and/or drug development, since it allows the immunoglobulin single variable domains of the invention to be tested in acknowledged disease models such as monkeys, in particular Cynomolgus or Rhesus, or mice and rats. Preferably, in view of cross-reactivity with one or more VEGF molecules from species 15 other than human that is/are intended for use as an animal model during development of a therapeutic VEGF antagonist, a VEGF-binding component recognizes an epitope in a region of the VEGF of interest that has a high degree of identity with human VEGF. An immunoglobulin single variable domain of the invention recognizes an epitope which is, totally or in part, located in a region of VEGF that is relevant for binding to its 20 receptor, in particular to VEGFR-2, which has been shown to be the receptor whose activation is causally involved in the neovascularisation of tumors. According to preferred aspects, immunoglobulin single variable domains of the invention block VEGF receptor activation, in particular VEGFR-2 activation, at least partially, preferably substantially and most preferably totally. 25 As described above, the ability of a VEGF-binding component to block the interaction between VEGF and its receptors, in particular the VEGFR-2, can be determined by an Amplified Luminescent Proximity Homogeneous Assay (AlphaScreen*), a competition ELISA, or a plasmon resonance (SPR) based assay (Biacore*), as described in the Examples. 34 WO 2012/131078 PCT/EP2012/055901 Preferably, an immunoglobulin single variable domain of the invention binds to VEGF with an affinity less than 500 nM, preferably less than 200 nM, more preferably less than 10 nM, such as less than 500 pM (as determined by Surface Plasmon Resonance analysis, as described in Example 5.7). The same is true for an immunoglobulin single 5 variable domain of the invention binds to angiopoietin. Preferably, the immunoglobulin single variable domains of the invention have IC50 values, as measured in a competition ELISA assay as described in Example 5.1. in the range of 10-6 to 10-10 moles/litre or less, more preferably in the range of 10-' to 10-10 moles/litre or less and even more preferably in the range of 10-9 to 10-10 moles/litre or 10 less. According to a non-limiting but preferred embodiment of the invention, VEGF-binding immunoglobulin single variable domains of the invention bind to VEGF with an dissociation constant (KD) of 10-5 to 1012 moles/liter (M) or less, and preferably 10-7 to 10-12 moles/liter (M) or less and more preferably 10-8 to 10-12 moles/liter (M), and/or with 15 an association constant (KA) of at least 107 M- 1 , preferably at least 108 M- 1 , more preferably at least 109 M- 1 , such as at least 1012 M-1 and in particular with a KD less than 500 nM, preferably less than 200 nM, more preferably less than 10 nM, such as less than 500 pM. The KD and KA values of the immunoglobulin single variable domain of the invention against VEGF can be determined. The same is true for an Ang2-binding 20 immunoglobulin single variable domain of the invention. Biparatopic VEGF-binding components comprising two or more immunoglobulin single variable domains essentially consist of or comprise (i) a first immunoglobulin single variable domain specifically binding to a first epitope of VEGF and (ii) a second immunoglobulin single variable domain specifically binding to a second epitope of 25 VEGF, wherein the first epitope of VEGF and the second epitope of VEGF are not identical epitopes. In other words, such polypeptide of the invention comprises or essentially consist of two or more immunoglobulin single variable domains that are directed against at least two non-overlapping epitopes present in VEGF, wherein said immunoglobulin single variable domains are linked to each other in such a way that they 30 are capable of simultaneously binding VEGF. In this sense, the polypeptide of the 35 WO 2012/131078 PCT/EP2012/055901 invention can also be regarded as a "bivalent" or "multivalent" immunoglobulin construct, and especially as a "multivalent immunoglobulin single variable domain construct", in that the polypeptide contains at least two binding sites for VEGF. (Such constructs are also termed "formatted" VEGF binding molecules, e.g. "formatted" VHHs). The same is 5 true for biparatopic Ang2-binding components, mutatis mutandis. Such VEGF-or Ang2-binding component of the invention includes (at least) two anti VEGF or Ang2 immunoglobulin single variable domains, respectively, wherein (the) two immunoglobulin single variable domains are preferably directed against non-overlapping epitopes within the VEGF molecule or angiopoietin molecule, respectively. Thus, these 10 two immunoglobulin single variable domains will have a different antigen specificity and therefore different CDR sequences. For this reason, such polypeptides of the invention will herein also be named "biparatopic polypeptides", or "biparatopic domain antibody constructs" (if the immunoglobulin single variable domains consist or essentially consist of domain antibodies), or "biparatopic VHH constructs" (if the immunoglobulin single 15 variable domains consist or essentially consist of VHHs), respectively, as the two immunoglobulin single variable domains will include two different paratopes. If a polypeptide of the invention is a biparatopic molecule as defined herein, at least one of the immunoglobulin single variable domain components binds to an epitope such that the interaction between recombinant human VEGF and recombinant humen VEGFR-2 is 20 blocked at an inhibition rate of 80%. As has been shown in experiments of the invention, certain formatted molecules contain two VHHs that both block the VEGFR2 receptor at an inhibition rate of 80%. Certain VHHs of the invention block the VEGFR-2 at an inhibition rate of 100%, i.e. they are complete blockers. In both cases, additional sequences and moieties may be present within the VEGF 25 binding components of the invention, e.g. N-terminally, C-terminally, or located between the two immunoglobulin single variable domains, e.g. linker sequences and sequences providing for effector functions, as set out in more detail herein. According to another, albeit less preferred embodiment, a VEGF-binding component of the invention may include more than two anti-VEGF immunoglobulin single variable 30 domains, i.e. three, four or even more anti-VEGF VHHs. In this case, at least two of the 36 WO 2012/131078 PCT/EP2012/055901 anti-VEGF immunoglobulin single variable domains are directed against non-overlapping epitopes within the VEGF molecule, wherein any further immunoglobulin single variable domain may bind to any of the two non-overlapping epitopes and/or a further epitope present in the VEGF molecule. 5 According to the invention, the two or more immunoglobulin single variable domains can be, independently of each other, VHHs or domain antibodies, and/or any other sort of immunoglobulin single variable domains, such as VL domains, as defined herein, provided that these immunoglobulin single variable domains will bind the antigen, i.e. VEGF or angiopoietin, respectively. 10 The detailed description of the binding components is primarily provided for the VEGF binding component. However, all features and options outlined herein for the VEGF binding component also apply equivalently for the Ang2-binding component, mutatis mutandis. According to preferred embodiments, the binding molecules present in the bispecific is binding molecules (the Ang2-binding molecules within the Ang2-binding component or the VEGF-binding molecules within the VEGF-binding component or the two adjacent Ang2- and VEGF-binding components) may be connected with each other directly (i.e. without use of a linker) or via a linker. The linker is preferably a linker peptide and will be selected so as to allow binding of the two different binding molecules to each of non 20 overlapping epitopes of the targets, either within one and the same target molecule, or within two different molecules. In the case of biparatopic binding molecules, selection of linkers within the Ang2- or the VEGF-binding component will inter alia depend on the epitopes and, specifically, the distance between the epitopes on the target to which the immunoglobulin single variable 25 domains bind, and will be clear to the skilled person based on the disclosure herein, optionally after some limited degree of routine experimentation. Two binding molecules (two VHHs or domain antibodies or VHH and a domain antibody), or two binding components, may be linked to each other via an additional VHH or domain antibody, respectively (in such binding molecules, the two or more 30 immunoglobulin single variable domains may be linked directly to said additional 37 WO 2012/131078 PCT/EP2012/055901 immunoglobulin single variable domain or via suitable linkers). Such an additional VHH or domain antibody may for example be a VHH or domain antibody that provides for an increased half-life. For example, the latter VHH or domain antibody may be one that is capable of binding to a (human) serum protein such as (human) serum albumin or 5 (human) transferrin. Alternatively, the two or more immunoglobulin single variable domains that bind to the respective target may be linked in series (either directly or via a suitable linker) and the additional VHH or domain antibody (which may provide for increased half-life) may be connected directly or via a linker to one of these two or more aforementioned 10 immunoglobulin sequences. Suitable linkers are described herein in connection with specific polypeptides of the invention and may - for example and without limitation - comprise an amino acid sequence, which amino acid sequence preferably has a length of 9 or more amino acids, more preferably at least 17 amino acids, such as about 20 to 40 amino acids. However, 15 the upper limit is not critical but is chosen for reasons of convenience regarding e.g. biopharmaceutical production of such polypeptides. The linker sequence may be a naturally occurring sequence or a non-naturally occurring sequence. If used for therapeutic purposes, the linker is preferably non-immunogenic in the subject to which the bispecific binding molecule of the invention is administered. 20 One useful group of linker sequences are linkers derived from the hinge region of heavy chain antibodies as described in W01996/34103 and WO1994/04678. Other examples are poly-alanine linker sequences such as Ala- Ala- Ala. Further preferred examples of linker sequences are Gly/Ser linkers of different length such as (glyxsery)z linkers, including (gly 4 ser) 3 , (gly 4 ser) 4 , (gly 4 ser), (gly 3 ser), gly 3 , and 25 (gly 3 ser 2 ) 3 . Some non-limiting examples of linkers are contained in bispecific binding molecules of the invention shown in Table 15 (SEQ ID NOs 128 - 168), e.g. the linkers GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS (35GS; SEQ ID NO: 169); 38 WO 2012/131078 PCT/EP2012/055901 GGGGSGGGS (9GS; SEQ ID NO: 170); GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS (40GS; SEQ ID NO: 171). If a formatted bispecific binding molecule of the invention is modified by the attachment 5 of a polymer, for example of a polyethylene glycol PEG (polyethylene glycol) moiety, the linker sequence preferably includes an amino acid residue, such as a cysteine or a lysine, allowing such modification, e.g. PEGylation, in the linker region. Examples of linkers useful for for PEGylation are: GGGGCGGGS ("GS9,C5", SEQ ID NO: 172); 10 GGGGCGGGGSGGGGSGGGGSGGGGS ("GS25,C5, SEQ ID NO:173) GGGSGGGGSGGGGCGGGGSGGGGSGGG ("GS27,C14", SEQ ID NO:174), GGGGSGGGGSGGGGCGGGGSGGGGSGGGGSGGGGS ("GS35,C15", SEQ ID NO:175), and GGGGCGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS ("GS35,C5", SEQ ID 15 NO:176). Furthermore, the linker may also be a poly(ethylene glycol) moiety, as shown in e.g. W02004/081026. In another embodiment, the immunoglobulin single variable domains are linked to each other via another moiety (optionally via one or two linkers), such as another polypeptide 20 which, in a preferred but non-limiting embodiment, may be a further immunoglobulin single variable domain as described above. Such moiety may either be essentially inactive or may have a biological effect such as improving the desired properties of the polypeptide or may confer one or more additional desired properties to the polypeptide. For example, and without limitation, the moiety may improve the half-life of the protein or 25 polypeptide, and/or may reduce its immunogenicity or improve any other desired property. 39 WO 2012/131078 PCT/EP2012/055901 According to a preferred embodiment, a bispecific binding molecule of the invention includes, especially when intended for use or used as a therapeutic agent, a moiety which extends the half-life of the polypeptide of the invention in serum or other body fluids of a patient. The term "half-life" is defined as the time it takes for the serum 5 concentration of the (modified) polypeptide to reduce by 50%, in vivo, for example due to degradation of the polypeptide and/or clearance and/or sequestration by natural mechanisms. More specifically, such half-life extending moiety can be covalently linked to or fused to an immunoglobulin single variable domain and may be, without limitation, an Fc portion, 10 an albumin moiety, a fragment of an albumin moiety, an albumin binding moiety, such as an anti-albumin immunoglobulin single variable domain, a transferrin binding moiety, such as an anti-transferrin immunoglobulin single variable domain, a polyoxyalkylene molecule, such as a polyethylene glycol molecule, an albumin binding peptide or a hydroxyethyl starch (HES) derivative. 15 In another embodiment, the bispecific binding molecule of the invention comprises a moiety which binds to an antigen found in blood, such as serum albumin, serum immunoglobulins, thyroxine-binding protein, fibrinogen or transferrin, thereby conferring an increased half-life in vivo to the resulting polypeptide of the invention. According to a specifically preferred embodiment, such moiety is an albumin-binding immunoglobulin 20 and, especially preferred, an albumin-binding immunoglobulin single variable domain such as an albumin-binding VHH domain. If intended for use in humans, such albumin-binding immunoglobulin single variable domain preferably binds to human serum albumin and preferably is a humanized albumin-binding VHH domain. 25 Immunoglobulin single variable domains binding to human serum albumin are known in the art and are described in further detail in e.g. W02006/122786. Specifically, useful albumin binding VHHs are ALB 1 and its humanized counterpart, ALB 8 (W02009/095489). Other albumin binding VHH domains mentioned in the above patent publication may, however, be used as well. 40 WO 2012/131078 PCT/EP2012/055901 A specifically useful albumin binding VHH domain is ALB8 which consists of or contains the amino acid sequence shown in SEQ ID NO: 98 or 254. According to a further embodiment of the invention, the two immunoglobulin single variable domains, in preferably VHHs, may be fused to a serum albumin molecule, such 5 as described e.g. in W02001/79271 and W02003/59934. As e.g. described in W02001/79271, the fusion protein may be obtained by conventional recombinant technology: a DNA molecule coding for serum albumin, or a fragment thereof, is joined to the DNA coding for the bispecific binding molecule, the obtained construct is inserted into a plasmid suitable for expression in the selected host cell, e.g. a yeast cell like 10 Pichia pastoris or a bacterial cell, and the host cell is then transfected with the fused nucleotide sequence and grown under suitable conditions. The sequence of a useful HSA is shown in SEQ ID NO: 99. According to another embodiment, a half-life extending modification of a polypeptide of the invention (such modification also reducing immunogenicity of the polypeptide) 15 comprises attachment of a suitable pharmacologically acceptable polymer, such as straight or branched chain poly(ethylene glycol) (PEG) or derivatives thereof (such as methoxypoly(ethylene glycol) or mPEG). Generally, any suitable form of PEGylation can be used, such as the PEGylation used in the art for antibodies and antibody fragments (including but not limited to domain antibodies and scFv's); reference is made, for 20 example, to: Chapman, Nat. Biotechnol., 54, 531-545 (2002); Veronese and Harris, Adv. Drug Deliv. Rev. 54, 453-456 (2003); Harris and Chess, Nat. Rev. Drug. Discov. 2 (2003); and W02004/060965. Various reagents for PEGylation of polypeptides are also commercially available, for example from Nektar Therapeutics, USA, or NOF Corporation, Japan, such as the 25 Sunbright@ EA Series, SH Series, MA Series, CA Series, and ME Series, such as Sunbright@ ME-100MA, Sunbright@ ME-200MA, and Sunbright@ ME-400MA. Preferably, site-directed PEGylation is used, in particular via a cysteine-residue (see for example Yang et a., Protein Engineering 16, 761-770 (2003)). For example, for this purpose, PEG may be attached to a cysteine residue that naturally occurs in a 30 polypeptide of the invention, a polypeptide of the invention may be modified so as to 41 WO 2012/131078 PCT/EP2012/055901 suitably introduce one or more cysteine residues for attachment of PEG, or an amino acid sequence comprising one or more cysteine residues for attachment of PEG may be fused to the N- and/or C-terminus of a polypeptide of the invention, all using techniques of protein engineering known per se to the skilled person. 5 Preferably, for the polypeptides of the invention, a PEG is used with a molecular weight of more than 5 kDa, such as more than 10 kDa and less than 200 kDa, such as less than 100 kDa; for example in the range of 20 kDa to 80 kDa. With regard to PEGylation, its should be noted that generally, the invention also encompasses any bispecific binding molecule that has been PEGylated at one or more 10 amino acid positions, preferably in such a way that said PEGylation either (1) increases the half-life in vivo; (2) reduces immunogenicity; (3) provides one or more further beneficial properties known per se for PEGylation; (4) does not essentially affect the affinity of the polypeptide for its target (e.g. does not reduce said affinity by more than 50 %, and more preferably not by more than 10%, as determined by a suitable assay 15 described in the art); and/or (4) does not affect any of the other desired properties of the bispecific binding molecules of the invention. Suitable PEG-groups and methods for attaching them, either specifically or non-specifically, will be clear to the skilled person. Various reagents for PEGylation of polypeptides are also commercially available, for example from Nektar Therapeutics, USA, or NOF Corporation, Japan, such as the 20 Sunbright@ EA Series, SH Series, MA Series, CA Series, and ME Series, such as Sunbright@ ME-100MA, Sunbright@ ME-200MA, and Sunbright@ ME-400MA. According to an especially preferred embodiment of the invention, a PEGylated polypeptide of the invention includes one PEG moiety of linear PEG having a molecular weight of 40 kDa or 60 kDa, wherein the PEG moiety is attached to the polypeptide in a 25 linker region and, specifially, at a Cys residue at position 5 of a GS9-linker peptide as shown in SEQ ID NO:93, at position 14 of a GS27-linker peptide as shown in SEQ ID NO:95, or at position 15 of a GS35-linker peptide as shown in SEQ ID NO:96, or at position 5 of a 35GS-linker peptide as shown in SEQ ID NO:97. 42 WO 2012/131078 PCT/EP2012/055901 A bispecific binding molecule of the invention may be PEGylated with one of the PEG reagents as mentioned above, such as "Sunbright@ ME-400MA", as shown in the following chemical formula: OH -( H 2 CH 2 On-CH2_CFH 2 CH 2 NHC (CH 5 Bispecific binding molecules that contain linkers and/or half-life extending functional groups are shown in SEQ ID NO: 81 and in Figure 48. According to another embodiment, the immunoglobulin single variable domains are domain antibodies, as defined herein. 10 Immunoglobulin single variable domains present in the bispecific binding molecules of the invention may also have sequences that correspond to the amino acid sequence of a naturally occurring VH domain that has been "camelized", i.e. by replacing one or more amino acid residues in the amino acid sequence of a naturally occurring variable heavy chain from a conventional 4-chain antibody by one or more amino acid residues 15 that occur at the corresponding position(s) in a VHH domain of a heavy chain antibody. This can be performed in a manner known per se, which will be clear to the skilled person, and reference is additionally be made to W01994/04678. Such camelization may preferentially occur at amino acid positions which are present at the VH-VL interface and at the so-called Camelidae Hallmark residues (see for example also 20 W01994/04678). A detailled description of such "humanization" and "camelization" techniques and preferred framework region sequences consistent therewith can additionally be taken from e.g. pp. 46 and pp. 98 of W02006/040153 and pp. 107 of W02006/122786. The binding components have specificity for Ang2 or VEGF, respectively, in that they 25 comprise in a preferred embodiment one or more immunoglobulin single variable domains specifically binding to one or more epitopes within the Ang2 molecule or within the VEGF molecule, respectively. 43 WO 2012/131078 PCT/EP2012/055901 Specific binding of a binding component to its antigen Ang2 or VEGF can be determined in any suitable manner known per se, including, for example, the assays described herein, Scatchard analysis and/or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA and ELISA) and sandwich 5 competition assays, and the different variants thereof known per se in the art. With regard to the antigen Ang2 or VEGF, respectively, an immunoglobulin single variable domain is not limited with regard to the species. Thus, the immunoglobulin single variable domains preferably bind to human Ang2 or to human VEGF, respectively, if intended for therapeutic purposes in humans. However, immunoglobulin 10 single variable domains that bind to Ang2 or VEGF, respectively, from another mammalian species, or polypeptides containing them, are also within the scope of the invention. An immunoglobulin single variable domain binding to one species form of Ang2 or VEGF may cross-react with the respective antigen from one or more other species. For example, immunoglobulin single variable domains binding to the human 15 antigen may exhibit cross reactivity with the respective antigen from one or more other species of primates and/or with the antigen from one or more species of animals that are used in animal models for diseases, for example monkey (in particular Cynomolgus or Rhesus), mouse, rat, rabbit, pig, dog or) and in particular in animal models for diseases and disorders that can be modulated by inhibition of Ang2 (such as the species and 20 animal models mentioned herein). Immunoglobulin single variable domains of the invention that show such cross-reactivity are advantageous in a research and/or drug development, since it allows the immunoglobulin single variable domains of the invention to be tested in acknowledged disease models such as monkeys, in particular Cynomolgus or Rhesus, or mice and rats. 25 Also, the binding components are not limited to or defined by a specific domain or an antigenic determinant of the antigen against which they are directed. Preferably, in view of cross-reactivity with one or more antigen molecules from species other than human that is/are intended for use as an animal model during development of a therapeutic Ang2NEGF antagonist, a binding component recognizes an epitope in a region of the 30 the respective antigen that has a high degree of identity with the human antigen. By way of example, in view of using a mouse model, an anti-Ang2 immunoglobulin single 44 WO 2012/131078 PCT/EP2012/055901 variable domain contained in the bispecific binding molecules of the invention recognizes an epitope which is, totally or in part, located within the FLD domain of Ang2, which shows a high identity between human and mouse. Preferably, the VEGF-binding component binds to the VEGF isoforms VEGF165 and/or 5 VEGF121. In another aspect, the invention relates to nucleic acid molecules that encode bispecific binding molecules of the invention. Such nucleic acid molecules will also be referred to herein as "nucleic acids of the invention" and may also be in the form of a genetic construct, as defined herein. A nucleic acid of the invention may be genomic DNA, 10 cDNA or synthetic DNA (such as DNA with a codon usage that has been specifically adapted for expression in the intended host cell or host organism). According to one embodiment of the invention, the nucleic acid of the invention is in essentially isolated form, as defined hereabove. The nucleic acid of the invention may also be in the form of, may be present in and/or is may be part of a vector, such as for example a plasmid, cosmid or YAC. The vector may especially be an expression vector, i.e. a vector that can provide for expression of the bispecific binding molecule in vitro and/or in vivo (i.e. in a suitable host cell, host organism and/or expression system). Such expression vector generally comprises at least one nucleic acid of the invention that is operably linked to one or more suitable 20 regulatory elements, such as promoter(s), enhancer(s), terminator(s), and the like. Such elements and their selection in view of expression of a specific sequence in a specific host are common knowledge of the skilled person. Specific examples of regulatory elements and other elements useful or necessary for expressing bispecific binding molecules of the invention, such as promoters, enhancers, terminators, integration 25 factors, selection markers, leader sequences, reporter genes, and the like, are disclosed e.g. on pp. 131 to 133 of W02006/040153. The nucleic acids of the invention may be prepared or obtained in a manner known per se (e.g. by automated DNA synthesis and/or recombinant DNA technology), based on the information on the amino acid sequences for the polypeptides of the invention given 30 herein, and/or can be isolated from a suitable natural source. 45 WO 2012/131078 PCT/EP2012/055901 In another aspect, the invention relates to host cells that express or that are capable of expressing one or more bispecific binding molecules of the invention; and/or that contain a nucleic acid of the invention. According to a particularly preferred embodiment, said host cells are bacterial cells; other useful cells are yeast cells, fungal cells or mammalian 5 cells. Suitable bacterial cells include cells from gram-negative bacterial strains such as strains of Escherichia coli, Proteus, and Pseudomonas, and gram-positive bacterial strains such as strains of Bacillus, Streptomyces, Staphylococcus, and Lactococcus. Suitable fungal cell include cells from species of Trichoderma, Neurospora, and Aspergillus. Suitable 10 yeast cells include cells from species of Saccharomyces (for example Saccharomyces cerevisiae), Schizosaccharomyces (for example Schizosaccharomyces pombe), Pichia (for example Pichia pastoris and Pichia methanolica), and Hansenula. Suitable mammalian cells include for example CHO cells, BHK cells, HeLa cells, COS cells, and the like. However, amphibian cells, insect cells, plant cells, and any other cells 15 used in the art for the expression of heterologous proteins can be used as well. The invention further provides methods of manufacturing a bispecific binding molecule of the invention, such methods generally comprising the steps of: - culturing host cells comprising a nucleic acid capable of encoding a bispecific binding molecule under conditions that allow expression of the bispecific binding molecule of the 20 invention; and - recovering or isolating the polypeptide expressed by the host cells from the culture; and - optionally further purifying and/or modifying and/or formulating the bispecific binding molecule of the invention. 25 For production on an industrial scale, preferred host organisms include strains of E. coli, Pichia pastoris, and S. cerevisiae that are suitable for large scale expression, production and fermentation, and in particular for large scale pharmaceutical expression, production and fermentation. 46 WO 2012/131078 PCT/EP2012/055901 The choice of the specific expression system depends in part on the requirement for certain post-translational modifications, more specifically glycosylation. The production of a bispecific binding molecule of the invention for which glycosylation is desired or required would necessitate the use of mammalian expression hosts that have the ability 5 to glycosylate the expressed protein. In this respect, it will be clear to the skilled person that the glycosylation pattern obtained (i.e. the kind, number and position of residues attached) will depend on the cell or cell line that is used for the expression. Bispecific binding molecules of the invention may be produced either in a cell as set out above intracellullarly (e.g. in the cytosol, in the periplasma or in inclusion bodies) and 10 then isolated from the host cells and optionally further purified; or they can be produced extracellularly (e.g. in the medium in which the host cells are cultured) and then isolated from the culture medium and optionally further purified. Methods and reagents used for the recombinant production of polypeptides, such as specific suitable expression vectors, transformation or transfection methods, selection 15 markers, methods of induction of protein expression, culture conditions, and the like, are known in the art. Similarly, protein isolation and purification techniques useful in a method of manufacture of a polypeptide of the invention are well known to the skilled person. In a further aspect, the invention relates to a peptide having an amino acid sequence of 20 a CDR3 contained in an anti-VEGF-VHH having an amino acid sequence selected from sequences shown in SEQ ID NOs: 9 to 57 or SEQ ID NOs: 58 - 127, respectively, and a nucleic acid molecule encoding same. These peptides correspond to CDR3s derived from the VHHs of the invention. They, in particular the nucleic acid molecules encoding them, are useful for CDR grafting in order 25 to replace a CDR3 in an immunoglobulin chain, or for insertion into a non immunoglobulin scaffold, e.g. a protease inhibitor, DNA-binding protein, cytochrome b562, a helix-bundle protein, a disulfide-bridged peptide, a lipocalin or an anticalin, thus conferring target-binding properties to such scaffold. The method of CDR-grafting is well known in the art and has been widely used, e.g. for humanizing antibodies (which 47 WO 2012/131078 PCT/EP2012/055901 usually comprises grafting the CDRs from a rodent antibody onto the Fv frameworks of a human antibody). In order to obtain an immunoglobulin or a non-immunoglobulin scaffold containing a CDR3 of the invention, the DNA encoding such molecule may be obtained according to 5 standard methods of molecular biology, e.g. by gene synthesis, by oligonucleotide annealing or by means of overlapping PCR fragments, as e.g. described by Daugherty et al., 1991, Nucleic Acids Research, Vol. 19, 9, 2471 - 2476. A method for inserting a VHH CDR3 into a non-immunoglobulin scaffold has been described by Nicaise et al., 2004, Protein Science, 13, 1882 - 1891. 10 The invention further relates to a product or composition containing or comprising at least one bispecific binding molecule of the invention and optionally one or more further components of such compositions known per se, i.e. depending on the intended use of the composition. For pharmaceutical use, a bispecific binding molecule of the invention may be is formulated as a pharmaceutical preparation or composition comprising at least one bispecific binding molecule of the invention and at least one pharmaceutically acceptable carrier, diluent or excipient and/or adjuvant, and optionally one or more further pharmaceutically active polypeptides and/or compounds. By means of non limiting examples, such a formulation may be in a form suitable for oral administration, 20 for parenteral administration (such as by intravenous, intramuscular or subcutaneous injection or intravenous infusion), for topical administration, for administration by inhalation, by a skin patch, by an implant, by a suppository, etc. Such suitable administration forms - which may be solid, semi-solid or liquid, depending on the manner of administration - as well as methods and carriers for use in the preparation thereof, will 25 be clear to the skilled person, and are further described herein. Thus, in a further aspect, the invention relates to a pharmaceutical composition that contains at least one bispecific binding molecule, in particular one immunoglobulin single variable domain, of the invention and at least one suitable carrier, diluent or excipient (i.e. suitable for pharmaceutical use), and optionally one or more further active 30 substances. 48 WO 2012/131078 PCT/EP2012/055901 The bispecific binding molecules of the invention may be formulated and administered in any suitable manner known per se: Reference, in particular for the immunoglobulin single variable domains, is for example made to W02004/041862, W02004/041863, W02004/041865, W02004/041867 and W02008/020079, as well as to the standard 5 handbooks, such as Remington's Pharmaceutical Sciences, 18 th Ed., Mack Publishing Company, USA (1990), Remington, the Science and Practice of Pharmacy, 2 1 th Edition, Lippincott Williams and Wilkins (2005); or the Handbook of Therapeutic Antibodies (S. Dubel, Ed.), Wiley, Weinheim, 2007 (see for example pages 252-255). For example, an immunoglobulin single variable domain of the invention may be 10 formulated and administered in any manner known per se for conventional antibodies and antibody fragments (including ScFv's and diabodies) and other pharmaceutically active proteins. Such formulations and methods for preparing the same will be clear to the skilled person, and for example include preparations suitable for parenteral administration (for example intravenous, intraperitoneal, subcutaneous, intramuscular, 15 intraluminal, intra-arterial or intrathecal administration) or for topical (i.e. transdermal or intradermal) administration. Preparations for parenteral administration may for example be sterile solutions, suspensions, dispersions or emulsions that are suitable for infusion or injection. Suitable carriers or diluents for such preparations for example include, without limitation, sterile 20 water and pharmaceutically acceptable aqueous buffers and solutions such as physiological phosphate-buffered saline, Ringer's solutions, dextrose solution, and Hank's solution; water oils; glycerol; ethanol; glycols such as propylene glycol or as well as mineral oils, animal oils and vegetable oils, for example peanut oil, soybean oil, as well as suitable mixtures thereof. Usually, aqueous solutions or suspensions will be 25 preferred. Thus, the bispecific binding molecule of the invention may be systemically administered, e.g., orally, in combination with a pharmaceutically acceptable vehicle such as an inert diluent or an assimilable edible carrier. For oral therapeutic administration, the bispecific binding molecule of the invention may be combined with one or more excipients and 30 used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, 49 WO 2012/131078 PCT/EP2012/055901 suspensions, syrups, wafers, and the like. Such compositions and preparations should contain at least 0.1% of the binding molecule of the invention. Their percentage in the compositions and preparations may, of course, be varied and may conveniently be between about 2 to about 60% of the weight of a given unit dosage form. The amount of 5 the bispecific binding molecule of the invention in such therapeutically useful compositions is such that an effective dosage level will be obtained. The tablets, pills, capsules, and the like may also contain binders, excipients, disintegrating agents, lubricants and sweetening or flavouring agents, for example those mentioned on pages 143-144 of W02008/020079. When the unit dosage form is a 10 capsule, it may contain, in addition to materials of the above type, a liquid carrier, such as a vegetable oil or a polyethylene glycol. Various other materials may be present as coatings or to otherwise modify the physical form of the solid unit dosage form. For instance, tablets, pills, or capsules may be coated with gelatin, wax, shellac or sugar and the like. A syrup or elixir may contain the binding molecules of the invention, sucrose or 15 fructose as a sweetening agent, methyl and propylparabens as preservatives, a dye and flavoring such as cherry or orange flavor. Of course, any material used in preparing any unit dosage form should be pharmaceutically acceptable and substantially non-toxic in the amounts employed. In addition, the bispecific binding molecules of the invention may be incorporated into sustained-release preparations and devices. 20 Preparations and formulations for oral administration may also be provided with an enteric coating that will allow the constructs of the invention to resist the gastric environment and pass into the intestines. More generally, preparations and formulations for oral administration may be suitably formulated for delivery into any desired part of the gastrointestinal tract. In addition, suitable suppositories may be used for delivery into the 25 gastrointestinal tract. The bispecific binding molecules of the invention may also be administered intravenously or intraperitoneally by infusion or injection, as further described on pages 144 and 145 of W02008/020079. For topical administration of the bispecific binding molecules of the invention, it will 30 generally be desirable to administer them to the skin as compositions or formulations, in 50 WO 2012/131078 PCT/EP2012/055901 combination with a dermatologically acceptable carrier, which may be a solid or a liquid, as further described on page 145 of W02008/020079. Generally, the concentration of the bispecific binding molecules of the invention in a liquid composition, such as a lotion, will be from about 0.1-25 wt-%, preferably from 5 about 0.5-10 wt-%. The concentration in a semi-solid or solid composition such as a gel or a powder will be about 0.1-5 wt-%, preferably about 0.5-2.5 wt-%. The amount of the bispecific binding molecules of the invention required for use in treatment will vary not only with the particular binding molecule selected, but also with the route of administration, the nature of the condition being treated and the age and 10 condition of the patient and will be ultimately at the discretion of the attendant physician or clinician. Also, the dosage of the binding molecules of the invention varies depending on the target cell, tumor, tissue, graft, or organ. The desired dose may conveniently be presented in a single dose or as divided doses administered at appropriate intervals, for example, as two, three, four or more sub-doses 15 per day. The sub-dose itself may be further divided, e.g., into a number of discrete loosely spaced administrations; such as multiple inhalations from an insufflator or by application of a plurality of drops into the eye. An administration regimen may include long-term, daily treatment. By "long-term" is meant at least two weeks and preferably, several weeks, months, or years of duration. 20 Necessary modifications in this dosage range may be determined by one of ordinary skill in the art using only routine experimentation given the teachings herein. See Remington's Pharmaceutical Sciences (Martin, E.W., ed. 4), Mack Publishing Co., Easton, PA. The dosage can also be adjusted by the individual physician in the event of any complication. 25 According to a further embodiment, the invention relates to the use of bispecific binding molecules, e.g. immunoglobulin single variable domains, for therapeutic purposes, such as - for the prevention, treatment and/or alleviation of a disorder, disease or condition, especially in a human being, that is associated with VEGF- and / or Ang2-mediated 51 WO 2012/131078 PCT/EP2012/055901 effects on angiogenesis or that can be prevented, treated or alleviated by modulating the Notch signaling pathway and/or the Tie2 signalling pathway with a bispecific binding molecule according to the invention, - in a method of treatment of a patient in need of such therapy, such method comprising 5 administering, to a subject in need thereof, a pharmaceutically active amount of at least one bispecific binding molecule of the invention, e.g. an immunoglobulin single variable domain, or a pharmaceutical composition containing same; - for the preparation of a medicament for the prevention, treatment or alleviation of disorders, diseases or conditions associated with VEGF- and/or Ang2-mediated 10 effects on angiogenesis; - as an active ingredient in a pharmaceutical composition or medicament used for the above purposes. According to a specific aspect, said disorder disorder, disease or condition is a cancer or cancerous disease, as defined herein. 15 According to another aspect, the disease is an eye disease associated with VEGF and/or Ang2-mediated effects on angiogenesis or which can be treated or alleviated by modulating the Notch signaling pathway with a bispecific binding molecule. Depending on the cancerous disease to be treated, a bispecific binding molecule of the invention may be used on its own or in combination with one or more additional 20 therapeutic agents, in particular selected from chemotherapeutic agents like DNA damaging agents or therapeutically active compounds that inhibit angiogenesis, signal transduction pathways or mitotic checkpoints in cancer cells. The additional therapeutic agent may be administered simultaneously with, optionally as a component of the same pharmaceutical preparation, or before or after administration 25 of the binding molecule. In certain embodiments, the additional therapeutic agent may be, without limitation (and in the case of the receptors, including the respective ligands), one or more inhibitors selected from the group of inhibitors of EGFR, VEGFR, HER2-neu, Her3, AuroraA, 52 WO 2012/131078 PCT/EP2012/055901 AuroraB, PLK and P13 kinase, FGFR, PDGFR, Raf, Ras, KSP, PDK1, PTK2, IGF-R or IR. Further examples of additional therapeutic agents are inhibitors of CDK, Akt, src/bcr abl, cKit, cMet/HGF, c-Myc, Flt3, HSP90, hedgehog antagonists, inhibitors of JAK/STAT, 5 MEK, mTor, NFkappaB, the proteasome, Rho, an inhibitor of wnt signaling or an inhibitor of the ubiquitination pathway or another inhibitor of the Notch signaling pathway. Examples for Aurora inhibitors are, without limitation, PHA-739358, AZD-1 152, AT 9283, CYC-116, R-763, VX-680, VX-667, MLN-8045, PF-3814735. An example for a PLK inhibitor is GSK-461364. 10 Examples for raf inhibitors are BAY-73-4506 (also a VEGFR inhibitor), PLX 4032, RAF-265 (also in addition a VEGFR inhibitor), sorafenib (also in addition a VEGFR inhibitor), and XL 281. Examples for KSP inhibitors are ispinesib, ARRY-520, AZD-4877, CK-1 122697, GSK 246053A, GSK-923295, MK-0731, and SB-743921. 15 Examples for a src and/or bcr-abl inhibitors are dasatinib, AZD-0530, bosutinib, XL 228 (also an IGF-1 R inhibitor), nilotinib (also a PDGFR and cKit inhibitor), imatinib (also a cKit inhibitor), and NS-187. An example for a PDK1 inhibitor is BX-517. An example for a Rho inhibitor is BA-210. 20 Examples for P13 kinase inhibitors are PX-866, BEZ-235 (also an mTor inhibitor), XL 418 (also an Akt inhibitor), XL-147, and XL 765 (also an mTor inhibitor). Examples for inhibitors of cMet or HGF are XL-1 84 (also an inhibitor of VEGFR, cKit, Flt3), PF-2341066, MK-2461, XL-880 (also an inhibitor of VEGFR), MGCD-265 (also an inhibitor of VEGFR, Ron, Tie2), SU-1 1274, PHA-665752, AMG-1 02, and AV-299. 25 An example for a c-Myc inhibitor is CX-3543. 53 WO 2012/131078 PCT/EP2012/055901 Examples for Flt3 inhibitors are AC-220 (also an inhibitor of cKit and PDGFR), KW 2449, lestaurtinib (also an inhibitor of VEGFR, PDGFR, PKC), TG-101348 (also an inhibitor of JAK2), XL-999 (also an inhibitor of cKit, FGFR, PDGFR and VEGFR), sunitinib (also an inhibitor of PDGFR, VEGFR and cKit), and tandutinib (also an inhibitor of PDGFR, and 5 cKit). Examples for HSP90 inhibitors are tanespimycin, alvespimycin, IPI-504 and CNF 2024. Examples for JAK/STAT inhibitors are CYT-997 (also interacting with tubulin), TG 101348 (also an inhibitor of Flt3), and XL-01 9. Examples for MEK inhibitors are ARRY-142886, PD-325901, AZD-8330, and XL 518. 10 Examples for mTor inhibitors are temsirolimus, AP-23573 (which also acts as a VEGF inhibitor), everolimus (a VEGF inhibitor in addition). XL-765 (also a P13 kinase inhibitor), and BEZ-235 (also a P13 kinase inhibitor). Examples for Akt inhibitors are perifosine, GSK-690693, RX-0201, and triciribine. Examples for cKit inhibitors are AB-1010, OSI-930 (also acts as a VEGFR inhibitor), 15 AC-220 (also an inhibitor of Flt3 and PDGFR), tandutinib (also an inhibitor of Flt3 and PDGFR), axitinib (also an inhibitor of VEGFR and PDGFR), XL-999 (also an inhibitor of Flt3, PDGFR, VEGFR, FGFR), sunitinib (also an inhibitor of Flt3, PDGFR, VEGFR), and XL-820 (also acts as a VEGFR- and PDGFR inhibitor), imatinib (also a bcr-abl inhibitor), nilotinib (also an inhibitor of bcr-abl and PDGFR). 20 Examples for hedgehog antagonists are IPI-609 and CUR-61414. Examples for CDK inhibitors are seliciclib, AT-7519, P-276, ZK-CDK (also inhibiting VEGFR2 and PDGFR), PD-332991, R-547, SNS-032, PHA-690509, and AG 024322. Examples for proteasome inhibitors are bortezomib, carfilzomib, and NPI-0052 (also an inhibitor of NFkappaB). 25 An example for an NFkappaB pathway inhibitor is NPI-0052. An example for an ubiquitination pathway inhibitor is HBX-41108. 54 WO 2012/131078 PCT/EP2012/055901 In preferred embodiments, the additional therapeutic agent is an anti-angiogenic agent. Examples for anti-angiogenic agents are inhibitors of the FGFR, PDGFR and VEGFR or the respective ligands (e.g VEGF inhibitors like pegaptanib or the anti-VEGF antibody bevacizumab), EGFL7 inhibitors, such as anti-EGFL7 MAb , angiopoietinl/2 inhibitors 5 such as AMG386, and thalidomides, such agents being selected from, without limitation, bevacizumab, motesanib, CDP-791, SU-14813, telatinib, KRN-951, ZK-CDK (also an inhibitor of CDK), ABT-869, BMS-690514, RAF-265, IMC-KDR, IMC-1 8F1, IMiDs (immunomodulatory drugs), thalidomide derivative CC-4047, lenalidomide, ENMD 0995, IMC-D1 1, Ki 23057, brivanib, cediranib, XL-999 (also an inhibitor of cKit and FIt3), 1 B3, 10 CP 868596, IMC 3G3, R-1 530 (also an inhibitor of F1t3), sunitinib (also an inhibitor of cKit and F1t3), axitinib (also an inhibitor of cKit), lestaurtinib (also an inhibitor of FIt3 and PKC), vatalanib, tandutinib (also an inhibitor of FIt3 and cKit), pazopanib, GW 786034, PF-337210, IMC-1121B, AVE-0005, AG-13736, E-7080, CHIR 258, sorafenib tosylate (also an inhibitor of Raf), RAF-265 (also an inhibitor of Raf), vandetanib, CP-547632, 15 OSI-930, AEE-788 (also an inhibitor of EGFR and Her2), BAY-57-9352 (also an inhibitor of Raf), BAY-73-4506 (also an inhibitor of Raf), XL 880 (also an inhibitor of cMet), XL-647 (also an inhibitor of EGFR and EphB4), XL 820 (also an inhibitor of cKit), and nilotinib (also an inhibitor of cKit and brc-abl). The additional therapeutic agent may also be selected from EGFR inhibitors, it may be a 20 small molecule EGFR inhibitor or an anti-EGFR antibody. Examples for anti-EGFR antibodies, without limitation, are cetuximab, panitumumab, matuzumab; an example for a small molecule EGFR inhibitor is gefitinib. Another example for an EGFR modulator is the EGF fusion toxin. Among the EGFR and Her2 inhibitors useful for combination with the bispecific binding 25 molecule of the invention are lapatinib, gefitinib, erlotinib, cetuximab, trastuzumab, nimotuzumab, zalutumumab, vandetanib (also an inhibitor of VEGFR), pertuzumab, XL-647, HKI-272, BMS-599626 ARRY-334543, AV 412, mAB-806, BMS-690514, JNJ-26483327, AEE-788 (also an inhibitor of VEGFR), ARRY-333786, IMC-11 F8, Zemab. 55 WO 2012/131078 PCT/EP2012/055901 Other agents that may be advantageously combined in a therapy with the bispecific binding molecule of the invention are tositumumab and ibritumomab tiuxetan (two radiolabelled anti-CD20 antibodies), alemtuzumab (an anti-CD52 antibody), denosumab, (an osteoclast differentiation factor ligand inhibitor), galiximab (a CD80 antagonist), 5 ofatumumab (a CD20 inhibitor), zanolimumab (a CD4 antagonist), SGN40 (a CD40 ligand receptor modulator), rituximab (a CD20 inhibitor), mapatumumab (a TRAIL-1 receptor agonist), REGN421 (SAR153192) or OMP-21 M18 (DII4 inhibitors). Other chemotherapeutic drugs that may be used in combination with the bispecific binding molecule of the present invention are selected from, but not limited to hormones, 10 hormonal analogues and antihormonals (e.g. tamoxifen, toremifene, raloxifene, fulvestrant, megestrol acetate, flutamide, nilutamide, bicalutamide, cyproterone acetate, finasteride, buserelin acetate, fludrocortisone, fluoxymesterone, medroxyprogesterone, octreotide, arzoxifene, pasireotide, vapreotide), aromatase inhibitors (e.g. anastrozole, letrozole, liarozole, exemestane, atamestane, formestane), LHRH agonists and 15 antagonists (e.g. goserelin acetate, leuprolide, abarelix, cetrorelix, deslorelin, histrelin, triptorelin), antimetabolites (e.g. antifolates like methotrexate, pemetrexed, pyrimidine analogues like 5 fluorouracil, capecitabine, decitabine, nelarabine, and gemcitabine, purine and adenosine analogues such as mercaptopurine thioguanine, cladribine and pentostatin, cytarabine, fludarabine); antitumor antibiotics (e.g. anthracyclines like 20 doxorubicin, daunorubicin, epirubicin and idarubicin, mitomycin-C, bleomycin dactinomycin, plicamycin, mitoxantrone, pixantrone, streptozocin); platinum derivatives (e.g. cisplatin, oxaliplatin, carboplatin, lobaplatin, satraplatin); alkylating agents (e.g. estramustine, meclorethamine, melphalan, chlorambucil, busulphan, dacarbazine, cyclophosphamide, ifosfamide, hydroxyurea, temozolomide, nitrosoureas such as 25 carmustine and lomustine, thiotepa); antimitotic agents (e.g. vinca alkaloids like vinblastine, vindesine, vinorelbine, vinflunine and vincristine; and taxanes like paclitaxel, docetaxel and their formulations, larotaxel; simotaxel, and epothilones like ixabepilone, patupilone, ZK-EPO); topoisomerase inhibitors (e.g. epipodophyllotoxins like etoposide and etopophos, teniposide, amsacrine, topotecan, irinotecan) and miscellaneous 30 chemotherapeutics such as amifostine, anagrelide, interferone alpha, procarbazine, mitotane, and porfimer, bexarotene, celecoxib. 56 WO 2012/131078 PCT/EP2012/055901 The efficacy of bispecific binding molecule of the invention or polypeptides, and of compositions comprising the same, can be tested using any suitable in vitro assay, cell based assay, in vivo assay and/or animal model known per se, or any combination thereof, depending on the specific disease or disorder of interest. Suitable assays and 5 animal models will be clear to the skilled person, and for example include the assays described herein and used in the Examples below, e.g. a proliferation assay. The data obtained in the experiments of the invention confirm that bispecific binding molecules of the invention have properties that are superior to those of binding molecules of the prior art. Among such properties are complete inhibition of the 10 VEGF165-VEGFR2 interaction and a low IC50, as can e.g. be taken from the ELISA data of Figure 1 and Table 5 as well as the IC50 (nM) values for VHHs in the AlphaScreen assay as shown in Figures 3, 17, 18 and Table 7; and the affinity KD (nM) of purified VHHs on recombinant human VEGF and mouse VEGF in Table 9, 10 and Figure 5. Also, as shown in Table 13, VEGF binders of the invention have high potency, 15 i.e. in the subnanomolar range, in the HUVEC proliferation assay. This indicates that bispecific binding molecules of the invention are promising candidates to have therapeutic efficacy in diseases and disorders associated with VEGF-mediated effects on angiogenesis, such as cancer. According to another embodiment of the invention, there is provided a method of 20 diagnosing a disease by a) contacting a sample with a binding molecule of the invention as defined above, and b) detecting binding of said binding molecule to said sample, and c) comparing the binding detected in step (b) with a standard, wherein a difference in 25 binding relative to said sample is diagnostic of a disease or disorder associated with VEGF- and/or Ang2-mediated effects on angiogenesis. For this and other uses, it may be useful to further modify a bispecific binding molecule of the invention, such as by introduction of a functional group that is one part of a specific binding pair, such as the biotin-(strept)avidin binding pair. Such a functional 57 WO 2012/131078 PCT/EP2012/055901 group may be used to link the binding molecule of the invention to another protein, polypeptide or chemical compound that is bound to the other half of the binding pair, i.e. through formation of the binding pair. For example, a bispecific binding molecule of the invention may be conjugated to biotin, and linked to another protein, polypeptide, 5 compound or carrier conjugated to avidin or streptavidin. For example, such a conjugated bispecific binding molecule of the invention may be used as a reporter, for example in a diagnostic system where a detectable signal-producing agent is conjugated to avidin or streptavidin. 10 Brief description of the Figures: Figure 1: Purified monovalent VHHs block the hVEGF165/hVEGFR2-Fc interaction (ELISA) Figure 2: Purified monovalent VHHs block the hVEGF165/hVEGFR1-Fc interaction (ELISA) is Figure 3: Purified monovalent VHHs block the hVEGF165/hVEGFR2-Fc interaction (AlphaScreen) Figure 4: Purified monovalent VHHs block the hVEGF165/hVEGFR1-Fc interaction (AlphaScreen) Figure 5: Binding of monovalent VHHs to recombinant human and mouse VEGF 20 (ELISA) Figure 6: Binding of monovalent VHHs to human VEGF121 Figure 7: Purified VHHs do not bind to VEGFB, VEGFC, VEGFD and PIGF Figure 8: Formatted VHHs block hVEGF165/hVEGFR2-Fc interaction (ELISA) Figure 9: Formatted VHHs block hVEGF165/hVEGFR1-Fc interaction (ELISA) 25 Figure 10: Formatted VHHs block hVEGF165/hVEGFR2-Fc interaction (AlphaScreen) 58 WO 2012/131078 PCT/EP2012/055901 Figure 11:Formatted VHHs block hVEGF165/hVEGFR1-Fc interaction (AlphaScreen) Figure 12: Formatted VHHs block mVEGF164/mVEGFR2-Fc interaction (AlphaScreen) 5 Figure 13: Formatted VHHs bind to mouse and human VEGF Figure 14: Formatted VHHs do not bind to VEGFB, VEGFC, VEGFD and PIGF Figure 15: Formatted VHHs bind to VEGF121 Figure 16: Sequence alignment of VHH VEGFBII23B04 with human VH3/JH germline consensus sequence 10 Figure 17: VHH variants of VEGFBII23B04 block hVEGF165/hVEGFR2-Fc interaction (AlphaScreen) Figure 18: Sequence-optimized clones of VEGFBII123B04 block the hVEGF165/hVEGFR2-Fc interaction (AlphaScreen) Figure 19: Sequence alignment of VHH VEGFBII5B05 with human VH3/JH 15 germline consensus sequence Figure 20: Description bivalent Ang2 VHHs Figure 21: Purified bivalent Ang2 VHHs blocking hAng2-hTie2 (25-1), mAng2-mTie2 (25-2) and cAng2-cTie2 (25-3) interaction (ELISA) Figure 22: Purified bivalent Ang2 VHHs blocking hAngl-hTie2 interaction (ELISA) 20 Figure 23: Description trivalent VEGFxAng2 bispecific VHHs Figure 24: Purified trivalent VEGFxAng2 Nanobodies blocking hVEGF-hVEGFR2 interaction (AlphaScreen) Figure 25: Purified trivalent VEGFxAng2 VHHs blocking hAng2-hTie2 interaction (ELISA) 59 WO 2012/131078 PCT/EP2012/055901 Figure 26: Description trivalent and tetravalent VEGFxAng2 bispecific VHHs Figure 27: Purified trivalent and tetravalent VEGFxAng2 VHHs blocking hVEGF hVEGFR2 (31-1) and hVEGF-hVEGFR1 (31-2) interaction (AlphaScreen) Figure 28: Purified trivalent and tetravalent VEGFxAng2 VHHs blocking hAng2-hTie2 5 (32-1), mAng2-mTie2 (32-2) and cAng2-cTie2 (32-3) interaction (ELISA) Figure 29: Purified trivalent and tetravalent VEGFxAng2 VHHs blocking hAng2 mediated HUVEC survival Figure 30: Description sequence optimized and affinity VEGFxAng2 bispecific VHHs Figure 31: Purified VEGFANGBII00022-25-28 VEGFxAng2 VHHs blocking hVEGF 10 hVEGFR2 (35-1) and hVEGF-hVEGFR1 (35-2) interaction (AlphaScreen) Figure 32: Purified VEGFANGBII00022-25-28 VEGFxAng2 VHHs binding to human VEGF165 (36-1) and hVEGF121 (36-2) (ELISA) Figure 33: Purified VEGFANGBII00022-25-28 VEGFxAng2 VHHs binding to (A) mouse and (B) rat VEGF164 (ELISA) 15 Figure 34: Purified VEGFANGBII00022-25-28 VEGFxAng2 VHHs binding to (A) human VEGF-B, (B) human VEGF-C, (C) human VEGF-D and (D) human PIGF (ELISA) Figure 35: Purified VEGFANGBII00022-25-28 VEGFxAng2 VHHs blocking hAng2 hTie2 (39-1), mAng2-mTie2 (39-2) and cAng2-cTie2 (39-3) interaction 20 (ELISA) Figure 36: Purified VEGFANGBII00022-25-28 VEGFxAng2 VHHs blocking hAng1 hTie2 interaction (ELISA) Figure 37: Purified VEGFANGBII00022-25-28 VEGFxAng2 VHHs blocking hAng2 mediated HUVEC survival 25 60 WO 2012/131078 PCT/EP2012/055901 Materials and methods: a) Production and functionality testing of VEGF109 A cDNA encoding the receptor binding domain of human vascular endothelial growth factor isoform VEGF165 (GenBank: AAM03108.1; AA residues 27 - 135) is cloned into 5 pET28a vector (Novagen, Madison, WI) and overexpressed in E.coli (BL21 Star DE3) as a His-tagged insoluble protein. Expression is induced by addition of 1 mM IPTG and allowed to continue for 4 hours at 370C. Cells are harvested by centrifugation and lysed by sonication of the cell pellet. Inclusion bodies are isolated by centrifugation. After a washing step with 1% Triton X 100 (Sigma-Aldrich), proteins are solubilized using 7.5M 10 guanidine hydrochloride and refolded by consecutive rounds of overnight dialysis using buffers with decreasing urea concentrations from 6M till OM. The refolded protein is purified by ion exchange chromatography using a MonoQ5/50GL (Amersham BioSciences) column followed by gel filtration with a Superdex75 10/300 GL column (Amersheim BioSciences). The purity and homogeneity of the protein is confirmed by 15 SDS-PAGE and Westen blot. In addition, binding activity to VEGFR1, VEGFR2 and Bevacizumab is monitored by ELISA. To this end, 1 pg/mL of recombinant human VEGF109 is immobilized overnight at 40C in a 96-well MaxiSorp plate (Nunc, Wiesbaden, Germany). Wells are blocked with a casein solution (1%). Serial dilutions of VEGFR1, VEGFR2 or Bevacizumab are added to the VEGF109 coated plate and 20 binding is detected using alkaline phosphatase (AP) conjugated goat anti-human IgG, Fc specific (Jackson Immuno Research Laboratories Inc., West Grove, PA, USA) and a subsequent enzymatic reaction in the presence of the substrate PNPP (p nitrophenylphosphate) (Sigma-Aldrich). VEGF109 could bind to VEGFR1, VEGFR2 and Bevacizumab, indicating that the produced VEGF109 is active. 25 b) KLH conjugation of VEGF165 and functionality testing of KLH-conjugated VEGF165 Recombinant human VEGF165 (R&D Systems, Minneapolis, MN, USA) is conjugated to mariculture keyhole limpet hemocyanin (mcKLH) using the Imject Immunogen EDC kit with mcKLH (Pierce, Rockford, IL, USA) according to the manufacturer's instructions. 30 Efficient conjugation of the polypeptide to mcKLH is confirmed by SDS-PAGE. 61 WO 2012/131078 PCT/EP2012/055901 Functionality of the conjugated protein is checked by ELISA: 2 pg/mL of KLH conjugated VEGF165 is immobilized overnight at 40C in a 96-well MaxiSorp plate (Nunc, Wiesbaden, Germany). Wells are blocked with a casein solution (1%). Serial dilutions of VEGFR1 or VEGFR2 are added and binding is detected using a horseradish peroxidase 5 (HRP)-conjugated goat anti-human IgG, Fc specific (Jackson Immuno Research Laboratories Inc., West Grove, PA, USA) and a subsequent enzymatic reaction in the presence of the substrate TMB (3,3',5,5'-tetramentylbenzidine) (Pierce, Rockford, IL, USA). The KLH conjugated protein could still interact with VEGFR1, VEGFR2 and Bevacizumab, confirming that the relevant epitopes onVEGF165 are still accessible. 10 Example 1 Immunization with different VEGF formats induces a humoral immune response in llama 1.1 Immunizations 15 After approval of the Ethical Committee of the faculty of Veterinary Medicine (University Ghent, Belgium), 4 llamas (designated No. 264, 265, 266, 267) are immunized according to standard protocols with 6 intramuscular injections (100 or 50 pg/dose at weekly intervals) of recombinant human VEGF109. The first injection at day 0 is formulated in Complete Freund's Adjuvant (Difco, Detroit, MI, USA), while the 20 subsequent injections are formulated in Incomplete Freund's Adjuvant (Difco, Detroit, MI, USA). In addition, four llamas (designated No. 234, 235, 280 and 281) are immunized according to the following protocol: 5 intramuscular injections with KLH conjugated human VEGH165 (100 or 50 pg/dose at biweekly intervals) followed by 4 intramuscular injections of human VEGF109 (first dose of 100 pg followed 2 weeks later 25 with three 50 pg/dose at weekly interval). 1.2 Evaluation of VEGF-induced immune responses in llama To monitor VEGF specific serum titers, an ELISA assay is set up in which 2 pg/mL of recombinant human VEGF165 or VEGF109 is immobilized overnight at 4'C in a 96-well MaxiSorp plate (Nunc, Wiesbaden, Germany). Wells are blocked with a casein solution 62 WO 2012/131078 PCT/EP2012/055901 (1 %). After addition of serum dilutions, bound total IgG is detected using horseradish peroxidase (HRP)-conjugated goat anti-llama immunoglobulin (Bethyl Laboratories Inc., Montgomery, TX, USA) and a subsequent enzymatic reaction in the presence of the substrate TMB (3,3',5,5'-tetramentylbenzidine) (Pierce, Rockford, IL, USA). For llamas 5 264, 265, 266 and 267, an additional ELISA is performed in which the isotype-specific responses against VEGF165 and VEGF 109 are evaluated. Isotype specific responses are detected using mouse mAbs specifically recognizing conventional llama IgG1 and the heavy-chain only llama IgG2 and IgG3 [Daley et al. (2005). Clin. Diagn. Lab. Imm. 12:380-386] followed by a rabbit anti-mouse-HRP conjugate (DAKO). ELISAs are 10 developed using TMB as chromogenic substrate and absorbance is measured at 450nm. The serum titers for each llama are depicted in Table 1. Table 1: Antibody-mediated specific serum response against VEGF165 and VEGF109 ELISA (recombinant protein solid phase coated) Recombinant human EGF165 Recombinant human VEGF109 Llama Immunogen Total IgG IgG1 IgG2 IgG3 Total lgG IgG1 IgG2 IgG3 VEGF165-KLH 234 ++ n/d n/d n/d ++ n/d n/d n/d + VEGF1O09 VEGF165-KLH 235 ++ n/d n/d n/d ++ n/d n/d n/d + VEGF1O09 VEGF165-KLH 280 + n/d n/d n/d + n/d n/d n/d + VEGF1O09 VEGF165-KLH 281 + n/d n/d n/d + n/d n/d n/d + VEGF109 1 63 WO 2012/131078 PCT/EP2012/055901 264 VEGF109 n/d ++ + + ++ ++ + + 265 VEGF109 n/d ++ + + + ++ + + 266 VEGF109 n/d ++ + +/- ++ ++ + +/ 267 VEGF109 n/d +/- - - +/- +/- - n/d, not detennined Example 2 Cloning of the heavy-chain only antibody fragment repertoires and preparation of 5 phage Following the final immunogen injection, immune tissues as the source of B-cells that produce the heavy-chain antibodies are collected from the immunized llamas. Typically, two 150-ml blood samples, collected 4 and 8 days after the last antigen injection, and one lymph node biopsy, collected 4 days after the last antigen injection are collected per 10 animal. From the blood samples, peripheral blood mononuclear cells (PBMCs) are prepared using Ficoll-Hypaque according to the manufacturer's instructions (Amersham Biosciences, Piscataway, NJ, USA). From the PBMCs and the lymph node biopsy, total RNA is extracted, which is used as starting material for RT-PCR to amplify the VHH encoding DNA segments, as described in W02005/044858. For each immunized llama, 15 a library is constructed by pooling the total RNA isolated from all collected immune tissues of that animal. In short, the PCR-amplified VHH repertoire is cloned via specific restriction sites into a vector designed to facilitate phage display of the VHH library. The vector is derived from pUC1 19 and contains the LacZ promoter, a M13 phage gIII protein coding sequence, a resistance gene for ampicillin or carbenicillin, a multiple 20 cloning site and a hybrid gIII-peIB leader sequence (pAX050). In frame with the VHH coding sequence, the vector encodes a C-terminal c-myc tag and a His6 tag. Phage are prepared according to standard protocols and stored after filter sterilization at 40C for further use. 64 WO 2012/131078 PCT/EP2012/055901 Example 3 Selection of VEGF-specific VHHs via phage display VHH phage libraries are used in different selection strategies applying a multiplicity of selection conditions. Variables include i) the VEGF protein format (rhVEGF165, 5 rhVEGF109 or rmVEGF164), ii) the antigen presentation method (solid phase: directly coated or via a biotin-tag onto Neutravidin-coated plates; solution phase: incubation in solution followed by capturing on Neutravidin-coated plates), iii) the antigen concentration and iv) the elution method (trypsin or competitive elution using VEGFR2). All selections are carried out in Maxisorp 96-well plates (Nunc, Wiesbaden, Germany). 10 Selections are performed as follows: Phage libraries are incubated at RT with variable concentrations of VEGF antigen, either in solution or immobilized on a solid support. After 2hrs of incubation and extensive washing, bound phage are eluted. In case trypsin is used for phage elution, the protease activity is immediately neutralized by addition of 0.8 mM protease inhibitor AEBSF. Phage outputs that show enrichment over 15 background are used to infect E. coli. Infected E. coli cells are either used to prepare phage for the next selection round (phage rescue) or plated on agar plates (LB+amp+glucose 2 %) for analysis of individual VHH clones. In order to screen a selection output for specific binders, single colonies are picked from the agar plates and grown in 1 mL 96-deep-well plates. The lacZ-controlled VHH expression is induced by 20 adding IPTG (0.1-1mM final). Periplasmic extracts (in a volume of ~ 80 pL) are prepared according to standard methods. Example 4 Identification of VEGF-binding and VEGF receptor-blocking VHHs 25 Periplasmic extracts are tested for binding to human VEGF165 by ELISA. In brief, 2 pg/mL of recombinant human VEGF165 is immobilized overnight at 40C in a 96-well MaxiSorp plate (Nunc, Wiesbaden, Germany). Wells are blocked with a casein solution (1%). After addition of typically a 10-fold dilution of the periplasmic extracts, VHH binding is detected using a mouse anti-myc (Roche) and an anti-mouse-HRP conjugate (DAKO). 65 WO 2012/131078 PCT/EP2012/055901 Clones showing ELISA signals of >3-fold above background are considered as VEGF binding VHHs. In addition, periplasmic extracts are screened in a human VEGF165/human VEGFR2 AlphaScreen assay (Amplified Luminescent Proximity Homogeneous Assay) to assess 5 the blocking capacity of the VHHs. Human VEGF165 is biotinylated using Sulfo-NHS LC-Biotin (Pierce, Rockford, IL, USA). Human VEGFR2/Fc chimera (R&D Systems, Minneapolis, MN, USA) is captured using an anti-humanFc VHH which is coupled to acceptor beads according to the manufacturer's instructions (Perkin Elmer, Waltham, MA, US). To evaluate the neutralizing capacity of the VHHs, periplasmic extracts are 10 diluted 1/25 in PBS buffer containing 0.03 % Tween 20 (Sigma-Aldrich) and preincubated with 0.4 nM biotinylated human VEGF165 for 15 minutes at room temperature (RT). To this mixture the acceptor beads (10pg/ml) and 0.4 nM VEGFR2 huFc are added and further incubated for 1 hour at RT in the dark. Subsequently donor beads (1Opg/ml) are added followed by incubation of 1 hour at RT in the dark. 15 Fluorescence is measured by reading plates on the Envision Multi label Plate reader (Perkin Elmer, Waltham, MA, USA) using an excitation wavelength of 680 nm and an emission wavelength between 520 nm and 620nm. Periplasmic extract containing irrelevant VHH is used as negative control. Periplasmic extracts containing anti VEGF165 VHHs which are able to decrease the fluorescence signal with more than 60 20 % relative to the signal of the negative control are identified as a hit. All hits identified in the AlphaScreen are confirmed in a competition ELISA. To this end, 1 pg/mL of human VEGFR2 chimera (R&D Systems, Minneapolis, MN, USA) is coated in a 96-well MaxiSorp plate (Nunc, Wiesbaden, Germany). Fivefold dilutions of the periplasmic extracts are incubated in the presence of a fixed concentration (4nM) of biotinylated 25 human VEGF165 in PBS buffer containing 0.1 % casein and 0.05 % Tween 20 (Sigma Aldrich). Binding of these VHH/bio-VEGF165 complexes to the human VEGFR2 chimera coated plate is detected using horseradish peroxidase (HRP) conjugated extravidin (Sigma, St Louis, MO, USA). VHH sequence IDs and the corresponding AA sequences of VEGF-binding (non-receptor-blocking) VHHs and inhibitory (receptor-blocking) VHHs 30 are listed in Table 2 and Table 3, respectively. 66 WO 2012/131078 PCT/EP2012/055901 OH O H OHOHO U) ) S 4 (r H < H 0 S d..H C D C Dm H m pL U) 05 0 oo o 0 viZ 2 o2 -L U D O S (D U H) HH 4H HU) U HH o a o4 04 U)m 4 4 o4 I- I- I- N I GG M H ZZj > > ZZ Z Z > u > -[ -i q i q i q i Qv4 Q l4 i o ZviSo ZviS Zi4 ZviS ZiS Zi4 0 o c H H H H C .H U < HO H 00 p o C 0 (o E * <U<)< o-- co << 4 < a< aZ 0 C U) F-4C 44H 44H -z 44H S-ouo o o o o o o o o o - NC (n .E 0 o o E F'4 S 4 W 4 W W O W - r14 e aQ eZ~ Z~ a F-H e eZ a cr r4 _ 2 (D C E 0 > F> >> 0U p 0 [--H Q H <Z -aci r1 aoe oo> a E U) O) >U> U) > >)U U >) >) U >> U) > < U (Uco ~ o az o aS o r o o az o az c 0 u O u (o )CC) 0) 0 0H LO H LO HHH H HQ P M m &Q CMl PQ o o Cl c m (D 4 H 44 1D 44D 44 -d 44CD 4 CI D 44 OCD . E m a 00 Q om 0 (o o M o W -- I W o o-I w o in w in - > n > D > D > D > D > D > D 67 WO 2012/131078 PCT/EP2012/055901 <0 0 > 0 > 0 > 0 > 0 > 0 > m OHH H OHOHHOHH SQ Q Q Q F'] Q QQ m 04 Q Q Q Q Q Q Q 04 QQ Q F F-H4 H F->EU H - H U H EU H U >EU HEU H 55 0 ZQ oZQ Z Q Z Q Z Q Z 2Q oCD 24 D H fIZZ U)Z U)Z U)Z D ~ U Z F-H U ~ FHZU F-H U FHZ F -HZ FZ FHZ 1-4 N G N N I- (:: I- (:: [- I- (:: > j u i uH H H p H u H Hij S i u H H oZHO CDmo o Oo o Zoo X oo CDoo H HO OZd Z > 0 > p 0 > i 0 > i F> 0 > O >4 >- 4 > - >4 [-> > - 44 > - > - 44 > - > - 44 > - >4 [- >4 <[-4 > OZa o O ao oao o~ o ao oa p-H F4-HS F-H F-HS F-H F-H p 0 - 0 H) -H U)H Z H Q H C H H N~ OH1N H NvF- OvH HO N H NvC OvH HvFN Q O QO CD Q>OC Q OCD 0 Q OCD 'OO F']O N OH 00 O NO N >m 00 0> > 04 O O a'] 68 WO 2012/131078 PCT/EP2012/055901 0 H 0 0 0 0 0 0 57 0 0) 1 Q a> a4 > a > 44 a> CD H o H Q oZ O S Q H H Q 4 o H U 0 H H Z OUQ QOSQ Q C Q C Q O m vlQ% viZM CDS 5 0 H) H d U H H U H H H U U HH HH HH HH HH FH HH HH ZQ ZQa Z CD> ZQ ZQa ZQa ZQ SN <H 5 u < > M p > p 04 a> e U)Z U)Z U) ) U U U )Z UDZ U)Z U) U) F-HU oFHZ HiZO F-HZ HZO F-HZ F-H< 2Z< H HHH H S H H H > H <4O H 0 0 > a O a a ao F -HSd -qQ 0H F-HHp -H F-HHd F-HS F-Hp F -HSF OC o Oe < Oe < OFH Oe < Oe < O < e 0 a0 q 0 0 QO PQ O o i o o o H H oZ oZ 44i OvD 44iC OD44-1i4CD 44iCD 44iCD 44iCD 44iCD C (Y)4 044uw 0 0 HOHiH Oi Hi OiD vH vH viH OvH 0m F CD CDoooo o D OCD OCD ~ CD OCD OCD _ 69 WO 2012/131078 PCT/EP2012/055901 0 0 0 0 0 0 0 0 p H) p H) H) H) p )) pp U oUD UOU OU oU) oU) oU) oUo OH OH oO OH OH oH OH oO 04o CD HH HH H F' Q 2 RQ RQ R Q C Q H Q Q Q CD Q S S>o m S H S Oo Z S S 5 0 H Q CDHH H 0 CD Q M 2 Q HO HO m 4 4 o44 4 4 4 4 HH HH HH HH HH FHH HH HH U)Z U) P" U) Z U)Z U)Z pDZ U)Z UDZ-q U)H U) >ZU F-H UU F-HZ F-HZ F- Z:FH U SH H oo H H o H QO U) C d Fd0 >i 0 >i O >-i HOd C O H C-d ZCD C D D CDCD CDCD C D CDS C D D H D C >4 [- o >4 [- >- >4 [- >- >4 [- >- >4 [- >- >4 [- 4 > - 4 [- > > > > IU > > U U >>4>>U HS NS H HN H >-i H > H N > 4 > a > a >a>a>a>a> S0 0 [0 1 0 0 0 Z) U) H- U)U CU ) U ) U )QDU )Q )U ) U )Q Ovl OvH 0 Ov1 Ovl Ogi- 0>H1CD PQOLO PQ 00 -O d mP QL QC OOD 00F4CD~C 70 WO 2012/131078 PCT/EP2012/055901 0 0 > 0 > m 0 > 0 > 0 > 0 Q H H S 0 U) a 4AM CDQ < D H F'H] H S S Z <Q >-4 < H <a < >< < 0 <- Q a oZZ S C D ZZM H OSH C 4QQ >- QQ Q HEU H U > H p U EU E7 U U) H U U pQS 4 0 PF' aS HC) aH H HH )H HH HH HH o4 o a o4 e a> a o o4 oa o o 1Q QQ Z ZQ ZQ ZQ O HH H H O - p [P 4 P H o U)Z uDQ UD) U)Z UDZ <- Z <- Z MZU F-HZ <- Z <- Z > ZO <- Z HOS HOS [-4 C HaS H-q HOS HOS H H H H So H H H HO o o Zo H o Q 0 0 0 o G A G B A OZ H G H B MAB > G o > u H > > u > > u > u o G > > u > > u > >- U > >- U > >- w >> U > <- U > >- U > >- U > >- U CC O 0 ,- HC4 m -V LO H 9 0 HP0Q 00 H 0 03 H 0 0EQ C D CDQ 71 CD>O O NO HN H N Hm O N F-C F-HS <- S HHQ U- S F-HS F-HH U-H m a o e o s oes es o e o >5 OCD ~ O ~ OCD 71O WO 2012/131078 PCT/EP2012/055901 0 0 ) ) ) 0 0 HCo H o H o H ) o ) o ) o )D 4O4 O O O OUD OUD OUD OH > OH> OH OH >H >H > S Q S Q SF] SF] C SF'] H H H H H H H H H H H H H H Z Q UDQ Z Q Q Z Q Q Z Q Q v Qm Qvl Qvl Qv F']vl Qvl HZU HZU HZU HZU HZU HZU HZU H H H H H H H F-AS F-A F-A F-S F-S FaS F-A 04 04 04 04 04 04 04 OvH OvH OvH OvH OvH OH OH U)Ur U)Ur UUr UUr UUr UUr UUr mooeoee mm mo m- mO mme mr-A e 00 OZ 00 0Z O o O r- Q' H03 H- 03 H- 03 H- 03 H - Hd H) 0 F']>O F'O F' F]O F']r-A N O FrAO G U G N G < G G O U GQ Ca 72 WO 2012/131078 PCT/EP2012/055901 0 0 0 0 0 0 0 U) U) ) H ) F'] U) CD>H~~5 0 DHCDC 0 >4 Q, > p >i 04 4 04 04 e ae a4 F a SQ oD US ) o7C CN SQ 55N < Q 05 QSd SQ a 0 CD Z Q Q Z Q Q Z Q Q Z Q Qm i 0 < H m U) f Q:) QH Qvl Q Qv : Q U)Z D ~ UD ~ Z UZ U)Z U)Z H EU H UH S H H CD MNO M O H F-HNO NO Z NO CDNO 4 > 4 > 4 >4 04 04 > 0>4 4 rQ 4 Q 44 < 4 Q 4Q Q 4 o 44 0 4 o 0 F < o> H CDHH H-< PQ Q -m 44 ~ ~ ~ C O-1 44 O- 411 4 D4411 4 - 4C on on] o] on on] on 0 4 0 44L 0 0 k 0r-0 0 C) 0 w ~ 0 W o 0 W o0 W-o 0 - - , o0 o o o o o - o o r- o o r- o o r- o o o H H H C H HCH H HHOvH Hvl Hv1 Hvl HvH O F'C]OO n']QO F']QO n']QO ']O O ']O O F' 00O >oCa > oCa >oCa > oCa >oCa ~>oa >0 vi~H73 WO 2012/131078 PCT/EP2012/055901 0 H]0 ] 0 0 0 OH O H O H O H O H OH OH OH Of U) mf: 0f Hf Qf u 04 G H ] O4H ) 1-4 H H H A QF-H o 0- [0 4 U) mc4 S 44 o Q O CuD O4 HS Do~ HO A ] A o F']S QDO QH pm 0m Q 44 QHq QHq QHq Q Hq QHq Q 1v ( Q U)Z U)Z U Z U)Z U)Z U)Z D ~ U Z H E u H E u H u H - H i U H E u H E u H E u Q 44 H H44a 00G HO G >O CO H Q CO FHOG m4 Ho Q U) o CoQ pQ H M H M H M H H H M H M H o < US US UQ U < ) < ) <4 a < U) < U) < I < <N < FH H H H Z Q Q Q oD v 0 OOH 00 U) OO) OO) omo eoo o o4'jom OF''o OOLC) 00W O O >4 >r4 > U O>4 U O>4 U O>4 U O>4 aO>r4 aO <4 44 74 I o oao oao o 0 1- P 0 <- P 0 <- p 0 Io Io Qe 0 [- p 0 1.4 0 0 1- P > u d > >o d > > d > > d > > d > > d > 9 d w -qU)U) w - U w 1- U w Iq ) Iq ) -q U)w74q U WO 2012/131078 PCT/EP2012/055901 OH O H O H O H O H OH OH s> m > o S> o o> w) F') U) wD QQ4 F-H H Fd F QZ Q QQ ZQ Q ZQ Q ZQ HH o ma o2 om 2 oF mo Ha4 a4 a4 a4 F a a H o4 1 ] Q 1 Q 1 4 4 1 Q 1 Q4 U)Z U)H U)Z U)Z UDZ 44 ) 11 I HZ) F-ZC pz F-H(- F-ZC U)Z F-Hz) p Z H > H < H H u H < m U -H H 0 H O mo H CD CD O NN CDZO N CDH HH HQ H4 aO> O aO F] a0 a a 0 0 04 04 Z F-H) H H F-H QH H QH H 4 H N H N H [-H N H [-H N H N[gDO F'OO F]H'OO FOO F']O F']O F]OO m00 00 G 0 00 g 00) 44]HCD 44]HCD 44]HCD 44]HCD 44]HCD 44]HCD 44]HCD mr-I m w oo oo w m oN o w oa omo >0 o- o > oo m> o a 75 WO 2012/131078 PCT/EP2012/055901 0 0) 0) 0) o OU oUD oUD oOUD E P4 oU 1 o 1-4 rn Q O Q O Q Q o. (U '4 i4 e e4e a -~ UEH CD) UEH U)FH 0) FH0 U)H0 Fd-) p0S ~0 443 > o o4 o-4 > o4 > : O P4 pQ4H p p 0 -(0 O w O S.. 2 +i-- Oi Z a O O o a i I OH] oo4 o O) OH]o a E/ DU UO H U) DU U) o U U) U)UD) DU) U) U >- 6 o o. c ( /)0 coz CZ (D U MC 0 9N0 (D r4 |- c >) ) >) cU>c)>ca> c < U) U) U) U7 <0 E0SSSS M U) C/ U~ C/D U) DO) an ci) OH] OH:) OH) O)(: ) ) ) U) p4 1: a']O F']OZ F']O 4 ] H0 L) H]0C) H]0C)) H]0 ) U C/) a 0 E F-HCD - I F-roFH o .- F-H PQ m- PQ Cc 01 w Co C1 76 WO 2012/131078 PCT/EP2012/055901 OUo OUo OUo OUo OUo OUo 04D 04 04D a a a <O QQ O Q OQ Q O 4 H Q HQ Q H Q Q H Q zF4 zF4 z4 z 4 z 4 z 4 U)H U)H U)H U) -H UDH) uF-H5 Q a U 04 U 04 U u P, 04A U M u H Fd U) Fd ) FH U) H S p -H FH FH Z SO Z UDO S O ZO SOG 0G SOG OH OH] OH OH] C/Do OH] o oU o oU o/U oZUD o > Z co o4 > o4 > o4 > o4 > o4 o- o4 > 4H o H UD O) 0) 0) 0 0) 0 o o o 0 o o 0 0 4 04 w] >4 Oo> 4 o OO> p oD > O CD OO> p O mL k o oo o r- oCC) o~ cn M o M C/QCD DQ D /DC/ C /DQCDCDQ/ C /DQ CD 77 WO 2012/131078 PCT/EP2012/055901 OU) OUD OUD OUD OUD OUD O Q OQ O sQ O sQ Qo HQo Qo HQo Qo HQo U) U U) ) U) F:J U) U U04U z 4 4 a4 aZ a4 4 >- >- H) HZ HZ HpZ H44 H>4 - >- Q H4 >-H-Q H4> S S O HA Z F-GA F-A F-A F-A oo Soo So Soo So> oz> o > o > o/U) C)U) U) > U> o> U > Uo o> C/U /DDCDU /U H H F-Ao H-Q H-AQ H-AQ HAQ oo o 0oo >-i >-, >-i >-i >-i >-i ) (: U ) U C U U D O U C U O > O oF> Oo O > Oo O > Oo O > Oo O > oO > 4Z r- F> Z r- ] 0< r- > 4 r- >] ]r H']OH H'OZH FH]OH H]ONH FH]ZH H]OZ a p 0 nn mr-A a pr- mmr-) p- m r-A p O Q Q G Pri G P-i G r wQ O' 44 OZ 44 004 78 WO 2012/131078 PCT/EP2012/055901 0 0 0 0 0 04D 04D a aU a a Q 04 Q Q Q Q4 Q Q4 U Ql Q Q4 U) Q U) ) p H Q) p Qo Qo oQo oQo U) U U U U) U) U U) > U) M HZ HZ HZ H H HZ 44D 44Q4 44 4 4 o>-o >-o >-o >i o- o>oi U)H U)FH U)H UDH> U)FH U)H o-Q0o o pQ o o 0Q o-Q0o o Q0o o Q p O U- CC 0) 0 LQ P F-0 F SS OH] OH] OH] OH] 4 D4 CD 44 C/D w/U wc-/w c-U D CDDU w/U ID C/DU C/DUD n c F-HU F-HU Q U F-U FQ FQ7 F'] F] F']F'] F] -| > Z 0 0 mZ mZ O 0 0 0 09 WO 2012/131078 PCT/EP2012/055901 OUo OUo OUo OUo OUo OUo 04D 04D 04D aUD aUD a O Q Q O Q Q 4 U Q Q H Q H Q HOG < H Q H Q w~ z4 z4 z 444 z 0 U) U U U 0 I- U ) U U U 0 I U HZ ZH HZ HZH o) > o) <: ) o) o) > ) > o) o U)H U)FH U)H U)H> U)H U)H HH]Q HH Q HH ~HHQ HH Q HH S [-1- 1 [- - 1 I -q - [-1- 1 [-1- 1 ) O U ) O U : US O US O U F U Oa4 > o > o o > ao ZO o O4 o O > o o O>o OH] e r OH O e r 4 OH]ra OH]ra O e ra U)U 0 )D)UD )U)U U)~ U) ~ U)DUD [-qU [-qU 44~ I-DU [-qU 444 4 - -q 4 -q Iq 4 r-Q Ca LQ O ow o 044 o r o i 0) wD mW CD CD CD Sn S SS C/DOC/DOUD ~ C/DOC/DOC8D WO 2012/131078 PCT/EP2012/055901 OU) oUD OUD OUD OUD OUD 4 04 a a4 a4 a 44 > 44 > F 4 > 44 > 44 > 44 > O Q OQ O QQ OQQ H Q H Q Q H Q Q H Q z44 z ~ ~ ~ ~ ZmQo Zmo ZmoQ U -) M P U U) P- U) > P-) U U) P- U) M P >- H HZ ;>- HZ HZ H- ;>-i e >-i >- H >-i e >-, U)H U)Z U)H UDH> UDH U)H W - 4O W0 4 W-> 0 44> w F-0> ~0 4404 oo4 o o So oao o o [q [-q -1[- [-q -1[- [-q- 44- U -1 [-q -1I- [-q -1 r-4 OH] OH] r- Or- Or OH] CC)U m/U OH0/U /U 44C4C/D44 C/DD 4~ -d/444 C/D O 0 0 (:)0 44 0 , >-1 >- 1 >-C/ C>- >- CD o QUo o QUo o QUo o QUo o QUo oDQ oD N00 03 0 - a Hm N H N H N H N H H Z--1O Z--1O Z--1O Z-H- Z[-H Z-11O 00 O G <OQ OZ OF'] G 8L 81 WO 2012/131078 PCT/EP2012/055901 04 04 04 04 OU OUDOU OU ) >) ) > ) > U) > H] H HH <O QQ OQ OQQ H Q H Q Q H Q Z x2m o m U)H U)H U)FH U)H U) U U U U U U) (: U o F-H Z H5 H HO 4 HO W H O 4 SOl O> 4 Z 4 S04F: oUD > o oo o)U ) C4/DDU D 44/-DU4DC O 0 0 :)0 4 o o C/O C/O C/O C O OUO OUDO F']UO O UDO H00 H00 H H m If)oo o O <GQ OZN 82 WO 2012/131078 PCT/EP2012/055901 Dissociation rates of inhibitory VHHs are analyzed on Biacore (Biacore T100 instrument, GE Healthcare). HBS-EP+ buffer is used as running buffer and experiments are performed at 25oC. Recombinant human VEGF165 is irreversibly captured on a CM5 sensor chip via amine coupling (using EDC and NHS) up to a target level of +/- 1500RU. 5 After immobilization, surfaces are deactivated with 10 min injection of 1 M ethanolamine pH8.5. A reference surface is activated and deactivated with respectively EDC/NHS and ethanolamine. Periplasmic extracts of VHHs are injected at a 10-fold dilution in running buffer for 2 min at 45pl/min and allowed to dissociate for 10 or 15 min. Between different samples, the surfaces are regenerated with regeneration buffer. Data are double 10 referenced by subtraction of the curves on the reference channel and of a blank running buffer injection. The of the processed curves is evaluated by fitting a two phase decay model in the Biacore T1 00 Evaluation software v2.0. 1. Values for kd-fast, kd-Slow and % fast are listed in Table 4. Table 4: Off-rate determination of anti-VEGF receptor-blocking VHHs with Biacore 15 B-cell Unqe Representative Binding level lineage sequence VHH Iv kd(fast) kd(slow) % fast (RU) variant 1 1 VEGFBIl22BO7 1.50E-02 7.80E-05 31 328 1 2 VEGFBIl23AO8 1.30E-02 5.OOE-05 19 502 1 3 VEGFBIl23BO4 8.80E-03 4.OOE-05 12 768 1 4 VEGFBIl27DO8 2.40E-02 8.1OE-05 13 225 1 5 VEGFBIl24C04 1.30E-02 3.40E-05 17 456 1 6 VEGFBIl27GO7 1.30E-02 3.80E-05 18 471 1 7 VEGFBIl22EO4 1.80E-02 1.10E-04 14 520 1 8 VEGFBIl23AO3 1.50E-02 3.20E-05 15 487 1 9 VEGFBIl22BO6 3.80E-02 9.OOE-05 23 168 1 10 VEGFBIl23AO9 2.70E-02 4.60E-05 20 247 1 11 VEGFBIl23GO3 2.80E-02 8.60E-05 28 141 1 12 VEGFBIl22A11 2.20E-02 4.70E-05 12 461 1 13 VEGFBIl23AO6 1.70E-02 3.70E-05 13 547 1 14 VEGFBIl23F11 2.70E-02 1.30E-04 22 134 1 15 VEGFBIl22A10 3.70E-02 4.OOE-05 19 229 1 16 VEGFBIl23FO5 1.60E-02 1.30E-04 29 198 83 WO 2012/131078 PCT/EP2012/055901 1 17 VEGFBIl23D11 1.90E-02 5.80E-05 13 510 1 18 VEGFBIl23FO2 n/d n/d n/d n/d 1 19 VEGFBIl23EO5 1.50E-02 6.90E-05 18 275 1 20 VEGFBIl31C07 3.70E-02 1.50E-04 25 77 1 21 VEGFBII30CO9 1.50E-02 7.60E-05 19 264 1 22 VEGFB1130E07 1.70E-02 1.30E-04 29 226 1 23 VEGFBIl39GO4 1.40E-02 7.40E-04 40 210 1 24 VEGFBIl41GO3 1.20E-02 2.70E-04 20 332 1 25 VEGFBIl41BO5 1.90E-02 1.20E-04 16 324 1 26 VEGFBI14OF02 1.20E-02 9.80E-05 20 258 1 27 VEGFBIl39EO2 1.90E-02 2.40E-04 13 181 1 28 VEGFBIl42DO5 3.30E-02 1.50E-04 26 77 1 29 VEGFBIl40GO7 1.80E-02 3.20E-04 19 139 1 30 VEGFBIl42AO5 1.60E-02 3.40E-04 25 118 1 31 VEGFBIl42F11 9.1OE-03 5.OOE-04 46 100 1 32 VEGFBI14OH10 1.40E-02 2.90E-04 17 200 1 33 VEGFBIl62AO9 4.1OE-02 1.10E-04 23 84 1 34 VEGFBI16OA09 3.70E-02 9.30E-05 20 106 1 35 VEGFBIl62FO2 1.40E-02 8.50E-05 21 205 1 36 VEGFBIl62D10 1.90E-02 1.60E-04 40 94 1 37 VEGFBl61AO1 7.40E-03 1.70E-04 21 275 1 38 VEGFBI156E11 3.30E-02 1.40E-04 24 76 n/d, not determined Example 5 Characterization of purified anti-VEGF VHHs Three inhibitory anti-VEGF VHHs are selected for further characterization as purified 5 protein: VEGFBII23B04, VEGFBII24C4 and VEGFBII23A6. These VHHs are expressed in E. coli TG1 as c-myc, His6-tagged proteins. Expression is induced by addition of 1 mM IPTG and allowed to continue for 4 hours at 370C. After spinning the cell cultures, periplasmic extracts are prepared by freeze-thawing the pellets. These extracts are used as starting material for VHH purification via IMAC and size exclusion chromatography 10 (SEC). Final VHH preparations show 95% purity as assessed via SDS-PAGE. 84 WO 2012/131078 PCT/EP2012/055901 5.1 Evaluation of human VEGF165/VEGFR2 blocking VHHs in human VEGF165/human VEGFR2-Fc blocking ELISA The blocking capacity of the VHHs is evaluated in a human VEGF165/human VEGFR2 Fc blocking ELISA. In brief, 1 pg/mL of VEGFR2-Fc chimera (R&D Systems, 5 Minneapolis, MN, USA) is coated in a 96-well MaxiSorp plate (Nunc, Wiesbaden, Germany). Dilution series (concentration range 1 mM - 64pM) of the purified VHHs in PBS buffer containing 0.1% casein and 0.05% Tween 20 (Sigma) are incubated in the presence of 4 nM biotinlyated VEGF165. Residual binding of bio-VEGF165 to VEGFR2 is detected using horseradish peroxidase (HRP) conjugated extravidin (Sigma, St Louis, 10 MO, USA) and TMB as substrate. As controls Bevacizumab (Avastin@) and Ranibizumab (Lucentis@) are taken along. Dose inhibition curves are shown in Figure 1; the corresponding IC50 values and % inhibition are summarized in Table 5. Table 5: IC50 (nM) values and % inhibition for monovalent VHHs in hVEGF165/hVEGFR2-Fc competition ELISA 15 VHH ID (nM) inhibition VEGFBII23B04 2.1 100 VEGFBII23A06 3.0 100 VEGFBII24C04 2.5 100 Ranibizumab 1.6 100 Bevacizumab 1.7 100 5.2 Evaluation of human VEGF165/VEGFR2 blocking VHHs in human VEGF165/human VEGFRI-Fc blocking ELISA VHHs are also evaluated in a human VEGF165/human VEGFR1-Fc blocking ELISA. In 20 brief, 2 pg/mL of VEGFR1-Fc chimera (R&D Systems, Minneapolis, MN, USA) is coated in a 96-well MaxiSorp plate (Nunc, Wiesbaden, Germany). Dilution series (concentration range 1 mM - 64pM) of the purified VHHs in PBS buffer containing 0.1% casein and 0.05% Tween 20 (Sigma) are incubated in the presence of 0.5nM biotinlyated 85 WO 2012/131078 PCT/EP2012/055901 VEGF165. Residual binding of bio-VEGF165 to VEGFR1 is detected using horseradish peroxidase (HRP) conjugated extravidin (Sigma, St Louis, MO, USA) and TMB as substrate. As controls Bevacizumab, Ranibizumab and an irrelevant VHH (2E6) are taken along. Dose inhibition curves are shown in Figure 2; the corresponding IC5o values 5 and % inhibition are summarized in Table 6. Table 6: IC50 (nM) values and % inhibition of monovalent VHHs in hVEGF165/hVEGFR1-Fc competition ELISA VHH ID IC 5 o (nM) inhibtion VEGFBII23B04 0.5 64 VEGFBII23A06 0.9 55 VEGFBII24C04 0.8 71 Ranibizumab 1.2 91 Bevacizumab 1.5 96 10 5.3 Evaluation of the anti-VEGF165 VHHs in the human VEGF165/human VEGFR2-Fc blocking AlphaScreen The blocking capacity of the VHHs is also evaluated in a human VEGF165/human VEGFR2-Fc blocking AlphaScreen. Briefly, serial dilutions of purified VHHs (concentration range: 200 nM - 0.7 pM) in PBS buffer containing 0.03 % Tween 20 is (Sigma) are added to 4pM bio-VEGF165 and incubated for 15 min. Subsequently VEGFR2-Fc (0.4 nM) and anti-Fc VHH-coated acceptor beads (20 pg/ml) are added and this mixture is incubated for 1 hour in the dark. Finally, streptavidin donor beads (20 pg/ml) are added and after 1 hour of incubation in the dark, fluorescence is measured on the Envision microplate reader. Dose-response curves are shown in the 20 Figure 3. The IC5o values for VHHs blocking the human VEGF165 - human VEGFR2-Fc interaction are summarized in Table 7. 86 WO 2012/131078 PCT/EP2012/055901 Table 7: IC50 (pM) values and % inhibition for VHHs in hVEGF165/hVEGFR2-Fc competition AlphaScreen VHH ID IC 50 (pM) inhibition VEGFBII23B04 160 100 VEGFBII23A06 250 100 VEGFBII24C04 250 100 Ranibizumab 860 100 5 5.4 Evaluation of the anti-VEGF165 VHHs in the human VEGF165/human VEGFRI-Fc blocking AlphaScreen The blocking capacity of the VHHs is also evaluated in a human VEGF165/human VEGFR1-Fc blocking AlphaScreen. Briefly, serial dilutions of purified VHHs (concentration range: 500 nM - 1.8 pM) ) in PBS buffer containing 0.03 % Tween 20 10 (Sigma) are added to 0.4 nM bio-VEGF165 and incubated for 15 min. Subsequently VEGFR1-Fc (1 nM) and anti-Fc VHH-coated acceptor beads (20 pg/ml) are added and this mixture is incubated for 1 hour in the dark. Finally, streptavidin donor beads (20 pg/ml) are added and after 1 hour of incubation in the dark, fluorescence is measured on the Envision microplate reader. Dose-response curves are shown in the is Figure 4. The IC5o values and % inhibition for VHHs blocking the human VEGF165 human VEGFR1-Fc interaction are summarized in Table 8. Table 8: IC5o (nM) values for VHHs in hVEGF165/hVEGFR1-Fc competition AlphaScreen VHH ID ICso (nM) % inhibition VEGFBII23BO4 0.9 41 VEGFBII23AO6 0.4 46 VEGFBII24C04 0.2 53 Ranibizumab 3.3 79 87 WO 2012/131078 PCT/EP2012/055901 5.5 Determination of the affinity of the human VEGF165 -VHH interaction Binding kinetics of VHH VEGFBII23B04 with hVEGF165 is analyzed by SPR on a Biacore T100 instrument. Recombinant human VEGF165 is immobilized directly on a CM5 chip via amine coupling (using EDC and NHS). VHHs are analyzed at different 5 concentrations between 10 and 360nM. Samples are injected for 2 min and allowed to dissociate up to 20 min at a flow rate of 45 pl/min. In between sample injections, the chip surface is regenerated with 100 mM HCI. HBS-EP+ (Hepes buffer pH7.4 + EDTA) is used as running buffer. Binding curves are fitted using a Two State Reaction model by Biacore T100 Evaluation Software v2.0.1. The calculated affinities of the anti-VEGF 10 VHHs are listed in Table 9. Table 9: Affinity KD (nM) of purified VHHs for recombinant human VEGF165 VEGF165 ka ka1 ka2 kd kdl kd2 KD VHH ID (M- 1 .s- 1 ) (M- 1 .s- 1 ) (M- 1 .s-) (s-) (s- 1 ) (s- 1 ) (nM) VEGFBII23B04(a) - 2.1E+05 1.4E-02 - 8.6E 2.4E-04 0.7 103 VEGFBII23A06(a) - 4.2E+05 2.0E-02 - 5.7E- 1.0E-04 0.7 02 VEGFBII24C04(a - 3.2E+05 1.8E-02 - 2.6E- 9.6E-05 0.4 (a) Heterogeneous binding curve resulting in no 1:1 fit, curves are fitted using a Two State Reaction model 15 by Biacore T100 Evaluation Software v2.0.1 88 WO 2012/131078 PCT/EP2012/055901 5.6 Binding to mouse VEGF164 Cross-reactivity to mouse VEGF164 is determined using a binding ELISA. In brief, recombinant mouse VEGF164 (R&D Systems, Minneapolis, MS, USA) is coated overnight at 40C at 1 pg/mL in a 96-well MaxiSorp plate (Nunc, Wiesbaden, Germany). 5 Wells are blocked with a casein solution (1% in PBS). VHHs are applied as dilution series (concentration range: 500nM - 32pM) in PBS buffer containing 0.1% casein and 0.05% Tween 20 (Sigma) and binding is detected using a mouse anti-myc (Roche) and an anti-mouse-HRP conjugate (DAKO) and a subsequent enzymatic reaction in the presence of the substrate TMB (3,3',5,5'-tetramentylbenzidine) (Pierce, Rockford, IL, 10 USA) (Figure 5). A mouse VEGF164 reactive mAb is included as positive control. As reference, binding to human VEGF165 is also measured. EC 50 values are summarized in Table 10. Table 10: EC 50 (pM) values for VHHs in a recombinant human VEGF165 and mouse VEGF164 binding ELISA 15 rhVEGF165 rmVEGF164 VHH ID EC 50 (pM) EC 50 (pM) VEGFBII23B04 297 NB VEGFBII24C04 453 NB VEGFBII23AO6 531 NB NB, no binding 5.7 Binding to VEGF121 Binding to recombinant human VEGF121 is assessed via a solid phase binding ELISA. 20 Briefly, recombinant human VEGF121 (R&D Systems, Minneapolis, MS, USA) is coated overnight at 40C at 1 pg/mL in a 96-well MaxiSorp plate (Nunc, Wiesbaden, Germany). Wells are blocked with a casein solution (1% in PBS). VHHs are applied as dilution series (concentration range: 500nM - 32pM) in PBS buffer containing 0.1% casein and 89 WO 2012/131078 PCT/EP2012/055901 0.05% Tween 20 (Sigma) and binding is detected using a mouse anti-myc (Roche) and an anti-mouse-HRP conjugate (DAKO) and a subsequent enzymatic reaction in the presence of the substrate TMB (3,3',5,5'-tetramentylbenzidine) (Pierce, Rockford, IL, USA) (Figure 6). As positive control serial dilutions of the VEGFR2 is taken along. EC 50 5 values are summarized in Table 11. Table 11: EC 5 o (pM) values for monovalent VHHs in a recombinant human VEGF121 binding ELISA VHH ID EC 5 o (pM) VEGFBII23B04 510 VEGFBI124C04 792 VEGFBII23A06 928 10 5.8 Binding to VEGF family members VEGFB, VEGFC, VEGFD and PIGF Binding to VEGFB, VEGFC, VEGFD and PIGF is assessed via a solid phase binding ELISA. In brief, VEGFB, VEGFC, VEGFD and PIGF (R&D Systems, Minneapolis, MS, USA) are coated overnight at 40C at 1 pg/mL in a 96-well MaxiSorp plate (Nunc, Wiesbaden, Germany). Wells are blocked with a casein solution (1 % in PBS). VHHs are is applied as dilution series (concentration range: 500nM - 32pM) and binding is detected using a mouse anti-myc (Roche) and an anti-mouse-AP conjugate (Sigma, St Louis, MO, USA). As positive controls serial dilutions of the appropriate receptors are taken along and detected with horseradish peroxidase (HRP)-conjugated goat anti-human IgG, Fc specific antibody (Jackson Immuno Research Laboratories Inc., West Grove, 20 PA, USA) and a subsequent enzymatic reaction in the presence of the substrate TMB (3,3',5,5'-tetramentylbenzidine) (Pierce, Rockford, IL, USA). Dose-response curves of VHHs and controls are shown in Figure 7. The results show that there was no detectable binding of the selected VHHs to VEGFB, VEGFC, VEGFD or PIGF. 90 WO 2012/131078 PCT/EP2012/055901 5.9 Epitope binning Biacore-based epitope binning experiments are performed to investigate which VEGF binders bind to a similar or overlapping epitope as VEGFBII23B04. To this end, VEGFBII23B04 is immobilized on a CM5 sensor chip. For each sample, human 5 VEGF165 is passed over the chip surface and reversibly captured by VEGFBII23B4. Purified VHHs (100 nM) or periplasmic extracts (1/10 diluted) are then injected with a surface contact time of 240 seconds and a flow rate of 10 uL/minute. Between different samples, the surface is regenerated with regeneration buffer (100 mM HCI). Processed curves are evaluated with Biacore T100 Evaluation software. VHHs could be divided 10 within two groups: group one which gave additional binding to VEGFBII23B04 captured VEGF165 and a second group which is not able to simultaneously bind to VEGFBII23B04 captured VEGF165. Table 12-A summarizes the binding epitopes of the tested VHHs. The same assay set-up is used to assess whether VEGFR1, VEGFR2, Ranibizumab 15 and Bevacizumab are able to bind to human VEGF-165 simultaneously with VEGFBII23B04. Table 12-B presents the additional binding responses to VEGFBII23B04-captured VEGF165. Only VEGFR2 is not able to bind to VEGFBII23B04-captured VEGF165, underscoring the blocking capacity of VEGFBII23B04 for the VEGF-VEGFR2 interaction. In addition, these data show that the 20 VEGFBII23B04 epitope is different from the Bevacizumab and Ranibizumab epitope. Table 12-A: Epitope binning of anti-VEGF VHHs - simultaneous binding with VEGFB11231B04 No or low 1C02 1E07 4B08 8E07 8F07 12A07 12B01 86C11 86F11 86G08 additional 86G10 86G11 87B07 88A01 88A02 88B02 88E02 88G03 88G05 88G11 binding to 23B04 captured 88H01 89B04 89D04 89F09 89G09 89H08 24C04 23A6 27G07 23B04 VEGF165* 91 WO 2012/131078 PCT/EP2012/055901 Additional 3D12 5B02 5B03 5B05 6G02 7D08 8D09 8F06 10C07 10E07 binding to 23B304 captured 10G04 10G05 11C08 11D09 11E04 11E05 11F12 86H09 41C05 VEGF165 * indicating same or overlapping epitopes Table 12-B: Epitope binning of VEGFBII23B04 - binding of benchmark inhibitors or cognate receptors on VEGFBII23B04 captured VEGF165 Injection Binding [sample] Binding step level (RU) 1 VEGF165 100 nM 1727 2 VEGFBII23B04 100 nM 3 Ranibizumab 100 nM 763 4 Bevacizumab 100 nM 1349 5 VEGFR1 100 nM 1011 6 VEGFR2 100nM 5 5.10 Characterization of the anti-VEGF VHHs in the HUVEC proliferation assay The potency of the selected VHHs is evaluated in a proliferation assay. In brief, primary HUVEC cells (Technoclone) are supplement-starved over night and then 4000 cells/well 10 are seeded in quadruplicate in 96-well tissue culture plates. Cells are stimulated in the absence or presence of VHHs with 33ng/mL VEGF. The proliferation rates are measured by [ 3 H] Thymidine incorporation on day 4. The results of the HUVEC proliferation assay are shown in Table. 15 92 WO 2012/131078 PCT/EP2012/055901 Table 13: IC50 (nM) values and % inhibition of monovalent VEGFBII23BO4, VEGFBII23AO6 and VEGFBI124C04 in VEGF HUVEC proliferation assay VHH ID IC 50 (nM) % inhibition VEGFBII23BO4 0.36 91 Bevacizumab 0.21 92 VHH ID IC 50 (nM) % inhibition VEGFBII23AO6 4.29 73 VEGFBII24C04 3.8 79 Bevacizumab 0.78 78 5 5.11 Characterization of the anti-VEGF VHHs in the HUVEC Erk phosphorylation assay The potency of the selected VHHs is assessed in the HUVEC Erk phosphorylation assay. In brief, primary HUVE cells are serum-starved over night and then stimulated in the absence or presence of VHHs with 1 Ong/mL VEGF for 5 min. Cells are fixed with 10 4% Formaldehyde in PBS and ERK phosphorylation levels are measured by ELISA using phosphoERK-specific antibodies (anti-phosphoMAP Kinase pERK1 &2, M8159, Sigma) and polyclonal Rabbit Anti-Mouse-Immunoglobulin-HRP conjugate (PO161, Dako). As shown in Table 14, VEGFBII23B04 and Bevacizumab inhibit the VEGF induced Erk phosphoryaltion by at least 90%, with IC5os <1nM. 93 WO 2012/131078 PCT/EP2012/055901 Table 14: IC50 (nM) values and % inhibition of monovalent VEGFBII23B04 in VEGF HUVEC Erk phosphorylation assay VHH ID IC 50 (nM) % inhibition VEGFBII23B04 0.37 90 Bevacizumab 0.63 98 5 Example 6 Generation of multivalent anti-VEGF blocking VHHs VHH VEGFBII23B04 is genetically fused to either VEGFBII23B04 resulting in a homodimeric VHH (AA sequence see Table 15) or different VEGF binding VHHs resulting in heterodimeric VHHs. To generate the heterodimeric VHHs, a panel of 10 10 unique VEGF binding VHHs are linked via a 9 or 40 Gly-Ser flexible linker in two different orientations to VEGFBII23B04 (AA sequences see Table 15). Homodimeric VEGFBII23B04 (VEGFBII010) and the 40 heterodimeric bivalent' VHHs are expressed in E. coli TG1 as c-myc, His6-tagged proteins. Expression is induced by addition of 1 mM IPTG and allowed to continue for 4 hours at 370C. After spinning the cell cultures, 15 periplasmic extracts are prepared by freeze-thawing the pellets. These extracts are used as starting material and VHHs are purified via IMAC and desalting resulting in 90% purity as assessed via SDS-PAGE. 94 WO 2012/131078 PCT/EP2012/055901 >OQ >(D (D(9 (D , (DF-> 0 ow mO0o o lt T o 0 > O3WW oE32 w n0>L JF (D F- -i U- j~ U~ U- i> I ( _0 3:~Z F- F- <fl: > (DO >w z >W - W Cl) > a W u) Wdo)W> &'2AU (D W~ W F- W ~ F-LLLLF- MW F (U < 0 c e f e oe < 3:-J-<< m *J> 4-- o - O w W j o _ 1=E w D T L D o Y w w o J>L i>0C j2- D0 o o< W-JW - -< WZw L< m ~ ~~~~~~~ o D0( y( yW 2F T-<0 > ( W-F C> w 0- 0 -0) (. 0- u L 2 00 L 0(I 0(3 0(o 0(o >f~f >>C >0), > > 0 > 0 W ( >w ww D F 95 WO 2012/131078 PCT/EP2012/055901 -JCDCDj j C9 CD -j -j F-- -CJ0 w D D ( C w0 (DJ F-~C >anag cy> WW >> ao aw >90 Z CDD Q~F- W F-- 0WZ OOWO oo-j oow< (D(OCD D WDDWH > (D ~ -J 2- 0 EE CD ofo b o0Dr _j =0 -1 2 mc m(N rn0 CDC n a C > It O ww O O DC tw IW Ow w "wo wo wD CDwow >0) ->0) >0L > 0) >LL >0) F- F- - < 3 3:96 WO 2012/131078 PCT/EP2012/055901 -J - (D z - -JW (9 o 3z -J (9 co 0) JD J 0 _jJU Z~OW ~ J > in >~> 00> 0 0n<z C 0 CY 00 Cyr 0 <<0 < F > O D (D > >u0- >W< U-U U U- UJ0w U- W F U00> w 0a - 0w w0<00 0< O _- j w- J W itc D z( (D u. < U- 0 0 rn < 0 4O- 0U- 0 0O 0U w N w N (N 0 0N U-(NWW 0>> wo w wa w wo w 0- CY - W97 WO 2012/131078 PCT/EP2012/055901 _j< Z0O M0zz (DU oww;.Cf9 o Waoz oww 0 >WWi O W c 5W F U- LWWw > ~ <U) (/2 >-< > >< > e > -iZa zc iz_ w CY w z~J wj w Y LD www> U- wUw Uw - W JUww w - w >U - w >W >U -J CY -J ':3-'-- 0) 2 O .o . o -. o 2 o. s o - c C~T - W~O mco >c =o 1 0 00 0w 0 w 0 0 00 D w w U- <8 WO 2012/131078 PCT/EP2012/055901 z8~~~~E (Da > ~Dj CU >-~~ >U (DDW WOw O 0y _jg W( (9<(D( F-(D(D( w t (9 Q L >>. (D~ > F-- 1 Cy2 0 C> - D (D( (D > F-(D - ) > < LL (9D~ > (9(D(D 0 (9H W - ( ( D (9 DH (~ (DH H <z(90~~L 00~W0~C < > (9 D c L(U F- O Z 0 Z>~ < (D 1)F- (9 J (DW ~ 9l >9~jU < 0 0 W W (D E F-> I >WH> W V.4 CY LL UJ( ,L cy LU 09 -Joe < L _ o L Tm It -i - It m2 0nc- (D t 0 >0)DC 02) >0 2 LL(D L 2 w 2F- 2299 WO 2012/131078 PCT/EP2012/055901 (D~n z < C) C <9 (D~ >DUJL LL- Dz (D( DL uD F- J( D L F->< U <Onw > -WWZOU JouF 0 Wu ujn >UC ( 9 Ofl;H:5 0 U (9( w wrj U> T-0 SH t 0 >W 0( -J (D(D9(DC W FH W 0 0 0 (O OO(D wO W H Q C J H U25 0 W ~ ~ W H W~> - 9 W ( < <~00 O - LI F 0L F-3 W LL0 y w - w Q F OW Ow F- Cy ct( - < o Iw<( it J WCJ oJ (D Ro >0D >0) >0) >': >':J< 0 > : 3: - 100 WO 2012/131078 PCT/EP2012/055901 -J >(o U- $- - UW (DW > ( C LL~j F-aF > L >w5 0 _D en Z w z( cj F->ZF Q(D D owCD5 WO (D3~ ItJU zf~~ (D-~ CY > j >H CY< 0 - W u) ZUD F- 0 W -F- T >~> z9 >~ w (9 _jW W 0 _j L W 0 0 Z w > 0 (D wU(>< 09(9 w D 0(9w (90W L >- > F- _ z LU F-> w z D LL CD CD C rn: j0( y3:r (9 Q0 0 wD 0 -2< ww2 DQF (Di z-r o-r >or corn: D ec D (9( (9( (D( (9( (D UJ UJzJ J J 101 WO 2012/131078 PCT/EP2012/055901 z 0>0 DQ F-(D (-i (D I ~JOO W ~ Jfl(D 9 U> (D0 ''-- ''. > -J N- 0 cQ (FD- (D m LL rL CNU Cy C F- W >9 UJ U-> Z( j L -i (D j 102 WO 2012/131078 PCT/EP2012/055901 The panel of 40 bivalent VHHs is tested in the VEGFR2 and VEGFR1 blocking AlphaScreen assay, as described in Example 5.3 and 5.4, respectively. Based on potency and maximum level of inhibition, the 5 best bivalent VHHs (VEGFBII021, VEGFBII022, VEGFBI023, VEGFBI024 and VEGFBII025) are chosen for further 5 characterization. An overview of the screening results for the 5 selected bivalent VHHs in the competitive VEGFR2 and VEGFR1 AlphaScreen is shown in Table 16. Table 16: Potency and efficacy of 5 best bivalent VHHs in the VEGFNEGFR1 and VEGFNEGFR2 competition AlphaScreen assay VHHID VEGFR2 VEGFR1 IC 50 (pM) IC 50 (pM) % inhibition VEGFBII021 9 16 100 VEGFBII022 7 8 100 VEGFBII023 38 44 91 VEGFBII024 12 46 100 VEGFBII025 51 39 82 10 Example 7 Characterization of formatted anti-VEGF VHHs VHHs VEGFBII010, VEGFBIIO21, VEGFBIIO22, VEGFBIIO23, VEGFBIIO24 and VEGFBIIO25 are compared side-by-side in the VEGFR2 and VEGFR1 blocking ELISA 15 (Figure 8 and 9, Table 17 and Table 18 respectively) and AlphaScreen assay (Figure 10 and 11, Table 19 and 20) as described in Examples 5.1, 5.2, 5.3 and 5.4, respectively. 103 WO 2012/131078 PCT/EP2012/055901 Table 17: IC50 (pM) values and % inhibition for formatted VHHs in hVEGF165/hVEGFR2-Fc competition ELISA VHH ID C 50 % inhibition (pM) VEGFBII010 49 100 VEGFBIIO21 204 100 VEGFBIIO22 164 100 VEGFBII023 213 100 VEGFBII024 292 100 VEGFBII025 577 100 Bevacizumab 315 100 Ranibizumab 349 100 5 Table 18: IC50 (pM) values and % inhibition of formatted VHHs in VEGF165/hVEGFR1 Fc competition ELISA VHH ID IC 50 % inhibition (pM) VEGFBIIO10 73.5 67 VEGFBIIO21 254 97 VEGFBIIO22 225 89 VEGFBIIO23 279 91 VEGFBIIO24 326 92 VEGFBIIO25 735 91 Bevacizumab 484 91 Ranibizumab 594 96 104 WO 2012/131078 PCT/EP2012/055901 Table 19: IC50 (pM) values and % inhibition for formatted VHHs in hVEGF165/hVEGFR2-Fc competition AlphaScreen VHH ID C 50 % inhibition (pM) VEGFBII010 16 100 VEGFBIIO21 7 100 VEGFBII022 7 100 VEGFBII023 46 100 VEGFBII024 50 100 VEGFBII025 51 100 Ranibizumab 600 100 5 Table 20: IC50 (pM) values and % inhibition of formatted VHHs in VEGF165/hVEGFR1 Fc competition AlphaScreen VHH ID IC 50 % inhibition (pM) VEGFBIIO10 21 70 VEGFBIIO21 12 100 VEGFBIIO22 9 98 VEGFBIIO23 48 87 VEGFBIIO24 69 98 VEGFBIIO25 71 82 Ranibizumab 1300 87 In addition, formatted VHHs are also tested for their capacity to block the 10 mVEGF164/mVEGFR2-huFc interaction. In brief, serial dilutions of purified VHHs 105 WO 2012/131078 PCT/EP2012/055901 (concentration range: 4 tM - 14.5 pM) in PBS buffer containing 0.03 % Tween 20 (Sigma) are added to 0.1 nM biotinylated mVEGF164 and incubated for 15 min. Subsequently mouse VEGFR2-huFc (0.1 nM) and anti-huFc VHH-coated acceptor beads (20 pg/ml) are added and this mixture is incubated for 1 hour. Finally, streptavidin 5 donor beads (20 pg/ml) are added and after 1 hour of incubation fluorescence is measured on the Envision microplate reader. Dose-response curves are shown in Figure 12. The IC5o values for VHHs blocking the mouse VEGF164NEGFR2-hFC interaction are summarized in Table 21. Table 21: IC50 (pM) values and % inhibition for formatted VHHs in 10 mVEGF164/mVEGFR2-hFc competition AlphaScreen VHH ID C 50 % inhibition (n M) VEGFBIIO22 108 100 VEGFBIIO24 - mVEGF164 0.05 100 Ranibizumab - The formatted VHHs are also tested in ELISA for their ability to bind mVEGF164 and human VEGF165 (Example 5.6; Figure 13; Table 22); VEGF121 (Example 5.7; 15 Figure 15; Table 23) and the VEGF family members VEGFB, VEGFC, VEGFD and PIGF (Example 5.8; Figure 14). Binding kinetics for human VEGF165 are analyzed as described in Example 5.5. The KD values are listed in Table 24. Table 22 EC 50 (pM) values for formatted VHHs in a recombinant human VEGF165 and mouse VEGF164 binding ELISA 20 rhVEGF165 rmVEGF164 VHH ID EC 50 (pM) EC 50 (pM) VEGFBII010 428 VEGFBIIO21 334 502 VEGFBIIO22 224 464 VEGFBIIO23 221 106 WO 2012/131078 PCT/EP2012/055901 VEGFBII024 320 VEGFBII025 668 Table 23: EC 50 (pM) values for formatted VHHs in a recombinant human VEGF121 binding ELISA rhVEGF121 VHH ID ECso (pM) VEGFBII100 920 VEGFBII022 540 VEGFBII024 325 VEGFBII025 475 5 Table 24: Affinity KD (nM) of purified formatted VHHs for recombinant human VEGF165 VHH ID 1Ms) kdl (1s) ka 2 (1s) kd2 (1/S) KD (nM)(a) VEGFBII010 (b) 4.5E+05 1.7E-02 2.9E-02 1.3E-04 0.16 VEGFBII021() 1.2E+06 1.1E-02 2.3E-02 1.9E-04 0.07 VEGFBII022(b) 1.2E+06 9.1E-03 1.4E-02 2.6E-04 0.14 VEGFBII023() 3.0E+05 1.8E-02 2.4E-02 2.7E-04 0.69 VEGFBII024(b) 3.0E+05 1.3E-02 2.6E-02 2.8E-04 0.47 VEGFBII025() 3.3E+05 1.7E-02 1.8E-02 3.7E-04 1.1 (a) KD= kd1/ka1*(kd2/(kd2+ka2)) (b) Curves are fitted using a Two State Reaction model by Biacore T100 Evaluation Software v2.0.1 10 VHHs VEGFBII010, VEGFBIIO22, VEGFBIIO24 and VEGFBIIO25 are also tested in the VEGF-mediated HUVEC proliferation and Erk phosphorylation assay. The potency of the selected formatted VHHs is evaluated in a proliferation assay. In brief, primary HUVEC cells (Technoclone) are supplement-starved over night and then 4000 cells/well are seeded in quadruplicate in 96-well tissue culture plates. Cells are 15 stimulated in the absence or presence of VHHs with 33ng/mL VEGF. The proliferation 107 WO 2012/131078 PCT/EP2012/055901 rates are measured by [ 3 H] Thymidine incorporation on day 4. The results shown in Table 25 demonstrate that the formatted VHHs and Bevacizumab inhibit the VEGF induced HUVEC proliferation by more than 90%, with IC5os <1 nM. 5 Table 25: IC50 (nM) values and % inhibition of formatted VHHs in VEGF HUVEC proliferation assay VHH ID IC 5 o (nM) % inhibition VEGFBII010 0.22 95 VEGFBII021 0.40 98 VEGFBII022 0.34 100 VEGFBII023 0.52 98 VEGFBII024 0.38 96 VEGFBII025 0.41 104 Bevacizumab 0.21 92 The potency of the selected formatted VHHs is assessed in the HUVEC Erk 10 phosphorylation assay. In brief, primary HUVE cells are serum-starved over night and then stimulated in the absence or presence of VHHs with 1 Ong/mL VEGF for 5 min. Cells are fixed with 4% Formaldehyde in PBS and ERK phosphorylation levels are measured by ELISA using phosphoERK-specific antibodies (anti-phosphoMAP Kinase pERK1&2, M8159, Sigma) and polyclonal Rabbit Anti-Mouse-Immunoglobulin-HRP 15 conjugate (PO161, Dako). As shown in Table 26, the formatted VHHs and Bevacizumab inhibit the VEGF induced Erk phosphoryaltion by more than 90%, with IC5os <1 nM. 108 WO 2012/131078 PCT/EP2012/055901 Table 26: IC50 (nM) values and % inhibition of formatted VHHs in VEGF HUVEC Erk phosphorylation assay VHH ID IC 50 (nM) % inhibition VEGFBII010 0.19 92 VEGFBII021 0.21 103 VEGFBII022 0.18 94 VEGFBII023 0.25 100 VEGFBII024 0.23 94 VEGFBII025 0.23 99 Bevacizumab 0.63 98 5 Example 8 Sequence optimization 8.1 Sequence optimization of VEGFBII23BO4 The amino acid sequence of VEGFBII23B04 is aligned to the human germline sequence VH3-23/JH5, see Figure 16 (SEQ ID NO: 179) 10 The alignment shows that VEGFBII23B04 contains 19 framework mutations relative to the reference germline sequence. Non-human residues at positions 14, 16, 23, 24, 41, 71, 82, 83 and 108 are selected for substitution with their human germline counterparts. A set of 8 VEGFBII23B04 variants is generated carrying different combinations of human residues at these positions (AA sequences are listed in Table 27). One additional 15 variant is constructed in which the potential isomerization site at position D59S60 (CDR2 region, see Figure 16, indicated as bold italic residues) is removed by introduction of a S60A mutation. 109 WO 2012/131078 PCT/EP2012/055901 F- F- F- I F- F- F- I 0 2 E IL mD H D0 04 0 0 u u u u w oC, <w <w <w ItItItT cu w w w NN I U- > (D) .0 / / / / (n 0 0>-> 4- Ew(u w( w(9 w( (D) >i H< >0 >0-W >H> 0 w -JO -JO 0w (D >U >U >U >U U ,U.. w(9w w 9lU- w 9lU- w(9 co m E0 0 c) LL LL -- 0 SE <~ I0 w J uJU wJ w 110 WO 2012/131078 PCT/EP2012/055901 F- F- F- F F- F- F- I- I n-iJw n-iJw n-iJw n-iJw nJw zzz F- < < LU 0 0 Hu 0 0 F-- F- 0 CEJ F- -JF- CE UL/2 (D L j UU2 (D L j LL j It~ QzU ItU Qz w Lu Lu uJ ~ L uJuJLJ > LL2 >/ (/2 >/ LL >/L2 L w(u w(9 w(9 w(9 w( > -> >0> >HF-> >HF-> >HF-> 0 w 0iYW 0 w -1 0< 10 w 0> 0 > 0> 0 > 0 > w(93jw w(93jw w(93jw w(93jw W(9 C') 10N ' LL 10 LL LE 1E w cv)w It qt ww 00 WO 2012/131078 PCT/EP2012/055901 These variants are characterized as purified proteins in the VEGF165NEGFR2 AlphaScreen (Example 5.3, Figure 17). The melting temperature (Tm) of each clone is determined in a thermal shift assay, which is based on the increase in fluorescence signal upon incorporation of Sypro Orange (Invitrogen) (Ericsson et al, Anal. Biochem. 357 (2006), pp289-298). All variants displayed comparable IC50 when compared to VEGFBII23B04 and Tm values which are similar or higher when compared to the parental VEGFBII23B04. Table 28 summarizes the ICo values and Tm values at pH 7 for the 9 clones tested. Table 28: IC50 (pM) values, % inhibition and melting temperature (@pH 7) of sequence optimized variants of VEGFBII23B04 VHH ID IC 5 o (pM) % inhibition Tm @ pH 7 (*C) VEGFBII23BO4 (wt) 169 100 63 VEGFBII111D05 209 100 68 VEGFBII111GO6 366 100 71 VEGFBII112D11 221 100 70 VEGFBII113AO8 253 100 69 VEGFBII113EO3 290 100 68 VEGFBII114C09 215 100 71 VEGFBII114D02 199 100 74 VEGFBII114D03 227 100 64 VEGFBII118E10 189 100 62 In a second cycle, tolerated mutations from the humanization effort (VEGFBII 11 G06) and mutations to avoid potential posttranslational modification at selected sites (the D16G, the S60A substitution and an El D mutation) are combined resulting in a sequence-optimized clone derived from VEGFBII23B04: VEGFBII0037. One extra sequence-optimized variant (VEGFBIIO38) is anticipated which contains the same substitutions as VEGFBII0037, with the exception of the 182M mutation, as this mutation may be associated with a minor drop in potency. The sequences from both sequence optimized clones are listed in Table 29. VEGFBII0037 and VEGFBII0038 are characterized in the VEGF165NEGFR2 blocking AlphaScreen (Example 5.3, Figure 18), the melting temperature is determined in the thermal shift assay as described above and the affinity for binding on VEGF165 is determined in Biacore 112 WO 2012/131078 PCT/EP2012/055901 (Example 5.5). An overview of the characteristics of the 2 sequence-optimized VHHs is presented in Table 30. Table 29: AA sequences of sequence-optimized variants of VHH VEGFBII23B04 VHH ID/ CDR SEQ ID FR1 FR2 CDR 2 FR3 CDR 3 FR4 NO: DVQLVES SYSM WFRQA AISKGG RFTISRDNAKNT SRAYGSSR WGQGT VEGFBIIO GGGLVQP G PGKERE YKYDA VYLQMNSLRPE LRLADTYEY LVTVSS 37 GGSLRLS FVV VSLEG DTAVYYCAS 56 CAASGRT FS DVQLVES SYSM WFRQA AISKGG RFTISRDNAKNT SRAYGSSR WGQGT VEGFBIIO GGGLVQP G PGKERE YKYDA VYLQINSLRPED LRLADTYEY LVTVSS 38 GGSLRLS FVV VSLEG TAVYYCAS 57 CAASGRT FS Table 30: IC50 (pM) values, % inhibition, melting temperature (@pH 7) and affinity (pM) of sequence-optimized clones VEGFBII037 and VEGFBII038 VHH ID IC 5 o (pM) i Tti(C) KD (pM) _____ ____ ____ inhibition @ pH 7 _ _ _ VEGFBIl23Bo4 152 100 63 560 VEGFBII037 300 100 72 270 /EGFB11038 143 100 71 360 8.2 Sequence optimization of VEGFBII5BO5 The amino acid sequence of VEGFBII5B05 is aligned to the human germline sequence VH3-23/JH5, see Figure 19 (SEQ ID:NO: 179 The alignment shows that VEGFBII5B05 contains 15 framework mutations relative to the reference germline sequence. Non human residues at positions 23, 60, 83, 105, 108 are selected for substitution with their 113 WO 2012/131078 PCT/EP2012/055901 human germline counterparts while the histidine at position 44 is selected for substitution by glutamine. One humanization variant is constructed carrying the 6 described mutations (AA sequence is listed in Table 31). Table 31: AA sequences of sequence-optimized variants of VHH VEGFBII5B05 (FR, framework; CDR, complementary determining region) Q ID FRI CDR FR2 CDR2 FR3 CDR3 FR4 SEQ ID NO: 1 EVQLVES RISSG RFTISRDNSK VEGFBI1119G GGGLVQP WYRQAP GTTA NTVYLQMNS FSSRP WGQGT 11/ GGSLRLS SMA GKQRELV YADS LRAEDTAVY NP LVTVSS 125 CAASGIR A VKG YCNT FM EVQLVES RISSG RFTISRDNSK VEGFBI1120E GGGLVQP WYRQAP TTA RTVYLQMNS FSSRP WGAGT 10/ GGSLRLS SMA GKHRELV YVDS LKAEDTAVY NP QVTVS 126 CVASGIR A VKG YCNT Fl One additional variant is constructed in which the potential oxidation site at position M30 (CDR1 region, see Figure 19 indicated as bold italic residue) is removed by introduction of a M301 mutation. Both variants are tested for their ability to bind hVEGF165 using the ProteOn. In brief, a GLC ProteOn Sensor chip is coated with human VEGF1 65. Periplasmic extracts of the variants are diluted 1/10 and injected across the chip coated with human VEGF165. Off-rates are calculated and compared to the off-rates of the parental VEGFBII5BO5. Off-rates from the 2 variants are in the same range as the off rates from the parental VEGFBII5B05 indicating that all mutations are tolerated (Table 32). Table 32: Off-rates sequence-optimized variants VEGFBII5B05 VHH ID binding level (RU) kd (1/s) VEGFBII5BO5 242 6.15E-02 VEGFBII119G11 234 7.75E-02 VEGFBII120E10 257 4.68E-02 114 WO 2012/131078 PCT/EP2012/055901 In a second cycle, mutations from the humanization effort and the M301 substitution are combined resulting in a sequence-optimized clone of VEGFBII5BO5, designated VEGFBIIO32. The sequence is listed in Table 33. Affinity of VEGFBIIO32 is determined by Biacore (see Example 5.5) and the melting temperature is determined in the thermal shift assay as described above. An overview of the characteristics of the sequence optimized VHH VEGFBI1032 is presented in Table 34. Table 33: AA sequence of sequence-optimized clone VEGFBI1032 (FR, framework, CDR, complementary determining region) VHH ID/ SEQ ID FRI C FR2 CDR2 FR3 CDR3 FR4 NO: EVQLVES RISSG RFTISRDNSK VEGFBI103 GGGLVQP WYRQAP GTTA NTVYLQMNS FSSR WGQGTL 2/ GGSLRLS SMA GKQRELV YADS LRAEDTAVY PNP VTVSS 127 CAASGIR A FIVKG YCNT Table 34: Melting temperature (@pH 7) and affinity (nM) of sequence-optimized clone VEGFBIIO32 VHHID { m (C KD(nM) VEGFBII5BO5(wt) 69 32 VEGFBII0032 71 44 The potency of the sequence-optimized clones VEGFBIIO37 and VEGFBIIO38 is evaluated in a proliferation assay. In brief, primary HUVEC cells (Technoclone) are supplement-starved over night and then 4000 cells/well are seeded in quadruplicate in 96-well tissue culture plates. Cells are stimulated in the absence or presence of VHHs with 33ng/mL VEGF. The proliferation rates are measured by [ 3 H] Thymidine incorporation on day 4. The results shown in Table 35, demonstrate that the activity 115 WO 2012/131078 PCT/EP2012/055901 (potency and degree of inhibition) of the parental VHH VEGFBII23BO4 is conserved in the sequence optimized clone VEGFBII038. Table 35: IC50 (nM) values and % inhibition of the sequence optimized clones VEGFBI1037 and VEGFBI1038 in VEGF HUVEC proliferation assay VHH ID IC 50 (nM) % inhibition VEGFBII23BO4 0.68 92 VEGFBII037 1.54 78 VEGFBIIO38 0.60 92 IBevacizumab 0.29 94 Example 9 Construction, production and characterization of bivalent VHHs targeting Ang2 VHHs 1D01 (SEQ ID No:214), 11B07, 00908 and 00027 (SEQ ID No:216) are genetically fused to 1 D01 (SEQ ID No: 214), 11 B07, 00908 and 00027 (SEQ ID No:216), respectively, resulting in homodimeric VHHs. The bivalent VHHs are linked via a 9-GlySer or 40-GlySer flexible linker. The encoding DNA sequences of the formatted VHHs are cloned in the expression vector pAX172. VHHs are expressed in Pichia pastoris as c-terminally myc - His6 tagged proteins. In brief, BGCM cultures are started from a single colony streak incubated over weekend at 30'C (250 rpm). After medium switch to BMCM, cultures are incubated until evening at 300C (250 rpm) and followed by an induction with 100% methanol. The next day the cultures are induced an additional 3 times (morning, afternoon, evening). The next day cultures are centrifuged for 20 min at 40C (1,500xg). The His6-tagged VHHs present in the supernatant are purified through immobilized metal affinity chromatography (IMAC) followed by desalting (DS) and finally gel filtration (GF) to remove any endotoxins/impurities. An overview of the format and sequence of all bivalent VHHs is depicted in Figure 20 and Table 36-A (linker sequences underlined), SEQ ID Nos 180-185. Expression levels are indicated in Table 36-B. To explore the anti-Ang2 blocking properties in comparison with the monovalent building blocks, bivalent VHHs are analyzed in a human Ang2/hTie2 (Figure 21-1), 116 WO 2012/131078 PCT/EP2012/055901 mouse Ang2/mTie2 (Figure 21-2), cyno Ang2/cTie2 (Figure 21-3) and human Ang1/hTie2 (Figure 22) competition ELISA. A summary of IC5o values is shown in Table 37. Table 36-A Sequences of bivalent VHH targeting Ang2 VHH ID AA sequence ANGBII00001 EVQLVESGGGLVQAGGSLRLSCAASGFTFDDYALGWFRQAAGKEREGVSCIRCSDGSTYYADSVKGR FTISSDNAKNTVYLQMNSLKPEDTAVYYCAASIVPRSKLEPYEYDAWGQGTLVTVSSGGGGSGGGSE VQLVESGGGLVQAGGSLRLSCAASGFTFDDYALGWFRQAAGKEREGVSCIRCSDGSTYYADSVKGRF TISSDNAKNTVYLQMNSLKPEDTAVYYCAASIVPRSKLEPYEYDAWGQGTLVTVSS (SEQ ID NO: 180) ANGBII00002 EVQLVESGGGLVQAGGSLRLSCAASGFTFDDYALGWFRQAAGKEREGVSCIRCSDGSTYYADSVKGR FTISSDNAKNTVYLQMNSLKPEDTAVYYCAASIVPRSKLEPYEYDAWGQGTLVTVSSGGGGSGGGGS GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQAGGSLRLSCAASGFTFDDYALGWF RQAAGKEREGVSCIRCSDGSTYYADSVKGRFTISSDNAKNTVYLQMNSLKPEDTAVYYCAASIVPRS KLEPYEYDAWGQGTLVTVSS (SEQ ID NO: 181) ANGBII00003 EVQLVESGGGLVQVGDSLRLSCAASGRTFSTYLMVGWFRQAPGKEREFAAGIWSSGDTAYADSVRGR FTI SRDNAKNTVYLQMNSLKTEDTAVYYCAGSYDGNYYIPGFYKDWGQGTLVTVSSGGGGSGGGSEV QLVESGGGLVQVGDSLRLSCAASGRTFSTYLMVGWFRQAPGKEREFAAGIWSSGDTAYADSVRGRFT ISRDNAKNTVYLQMNSLKTEDTAVYYCAGSYDGNYYIPGFYKDWGQGTLVTVSS (SEQ ID NO: 182) ANGBII00004 EVQLVESGGGLVQAGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSSIRDNDGSTYYADSVKGR FTISSDNDKNTVYLQMNSLKPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSSGGGGS GGGSEVQLVESGGGLVQAGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSSIRDNDGSTYYADS VKGRFTISSDNDKNTVYLQMNSLKPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSS (SEQ ID NO: 183) ANGBII00005 EVQLVESGGGLVQAGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSSIRDNDGSTYYADSVKGR FTISSDNDKNTVYLQMNSLKPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSSGGGGS GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQAGGSLRLSCAASGFTLDDY AIGWFRQAPGKEREGVSSIRDNDGSTYYADSVKGRFTISSDNDKNTVYLQMNSLKPEDTAVYYCAAV PAGRLRFGEQWYPLYEYDAWGQGTLVTVSS (SEQ ID NO: 184) ANGBII00006 EVQLVESGGGLVQPGGSLRLSCAASGITLDDYAIGWFRQAPGKEREGVSSIRDNGGSTYYADSVKGR FTISSDNSKNTVYLQMNSLRPEDTAVYYCAAVPAGRLRYGEQWYPIYEYDAWGQGTLVTVSSGGGGS GGGSEVQLLESGGGLVQPGGSLRLSCAASGITLDDYAIGWFRQAPGKEREGVSSIRDNGGSTYYADS VKGRFTISSDNSKNTVYLQMNSLRPEDTAVYYCAAVPAGRLRYGEQWYPIYEYDAWGQGTLVTVSS (SEQ ID NO: 185) 117 WO 2012/131078 PCT/EP2012/055901 Table 36-B VHH ID Format Expression (mg/L) ANGBIIOOO01 > 31 ANGBIIOOO02 37 ANGB1100003 28 ANGB1100004 651 ANGB1100005 203 ANGB1100006 3 Table 37: IC50 values (pM) in human Ang2/human Tie2, mouse Ang2/mouse Tie2, cyno Ang2/cyno Tie2 and hAngl/hTie2 competition ELISA. hAng2 mAng2 cAng2 hAngl/hAng2 ratio VHH ID Format50 VH I Frmt(pM) (pM) (pM) 1D01 6,973 10,455 9,484 >10,800 ANGB1100001 11 18 27 n.d. ANGB1100002 20 32 n.d. n.d. 11B07 15,205 10,000 16,400 > 8,570 ANGBIIOOO03 24 47 35 n.d. 00027 541 1,785 568 >14,878 ANGBIIOOO04 17 33 34 n.d. ANGBIIOOO05 13 32 n.d. n.d. 00908 52 85 79 >192,014 ANGBIIOOO06 19 28 25 6,052,631 AMG386 4 3 10 5,600 n.d., not determined 118 WO 2012/131078 PCT/EP2012/055901 Example 10 Construction, production and characterization of trivalent bispecific VHHs targeting VEGF and Ang2 using anti-serum abumin as half-life extension The anti-VEGF VHH VEGFBI100038 (US 2011/0172398 Al) and the anti-Ang2 VHH 00027 (SEQ ID No:216) are used as building blocks to generate bispecific VHHs VEGFANGBII00001 -00004. A genetic fusion to a serum albumin binding VHH is used as half-life extension methodology. Building blocks are linked via a triple Ala or 9 Gly Ser flexible linker. VHHs are produced and purified as described in Example 9. An overview of the format and sequence of all four bispecific VHHs is depicted in Figure 23 and Table 37-A (linker sequences underlined), SEQ ID Nos 186-189. Expression levels are indicated in Table 38-B. Table 38-A Sequences of bispecific VHH targeting VEGF and Ang2 VHH ID AA sequence VEGFANGBII00001 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQAGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSSIRDNDGSTYYADSVKGRFTISSDNDKN TVYLQMNSLKPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSS (SEQ ID NO: 186) VEGFANGBII00002 EVQLVESGGGLVQAGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSSIRDNDGSTYYADSVKGR FTISSDNDKNTVYLQMNSLKPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSSGGGGS GGGSEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADS VKGRFTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSDVQLVE SGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRFTISRDN AKNTVYLQINSLRPEDTAVYYCASSRAYGSSRLRLADTYEYWGQGTLVTVSS (SEQ ID NO: 187) VEGFANGBII00003 EVQLVESGGGLVQAGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSSIRDNDGSTYYADSVKGR FTISSDNDKNTVYLQMNSLKPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSSGGGGS GGGSDVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSL EGRFTI SRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGS SRLRLADTYEYWGQGTLVTVSSGGGGS GGGSEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADS VKGRFTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSS (SEQ ID NO: 188) VEGFANGBII00004 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TI SRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGS SRLRLADTYEYWGQGTLVTVSSAAAEVQLVE SGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGRFTISRD NAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSAAAEVQLVESGGGLVQAGGSLRLSC AASGFTLDDYAIGWFRQAPGKEREGVSSIRDNDGSTYYADSVKGRFTISSDNDKNTVYLQMNSLKPE DTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSS (SEQ ID NO: 189) 119 WO 2012/131078 PCT/EP2012/055901 Table 38-B VHH ID Format Expression (mg/L) VEGFANGB1100001 13.3 VEGFANGBIIOOO02 11.3 VEGFANGBIIOOO03 15.4 VEGFANGBIIOOO04 19.2 To explore the anti-VEGF blocking properties in comparison with the monovalent building block VEGFB1100038, all four bispecific VHHs are analyzed in the VEGF/VEGFR2-Fc (Figure 22) competition AlphaScreen. The assay is slightly adjusted compared to Example 12.3 described in patent US 2011/0172398 Al. Both human VEGF165 and human VEGFR2-Fc are added at 0.05 nM. This competition assay is also performed after preincubation of the VHH with 25 pM human serum albumin. A summary of ICo values and % inhibition is shown in Table 39. Table 39: IC50 values (nM) in human VEGF165/human VEGFR2 competition AlphaScreen VHH ID Format HSA IC5o % (nM) inh - 0.5 100 VEGFB1100038 + 0.5 100 0.4 100 VEGFANGB31100001 + 0.6 100 VEGFANGBIIOOO02 0.7 10 0.6 100 VEGFANGBIIOO03 0 + 1.3 100 120 WO 2012/131078 PCT/EP2012/055901 VEGFANGBIIOOO04 0.7 100 - 0.8 100 Ranibizumab + 1.1 100 To explore the anti-Ang2 blocking properties in comparison with the monovalent building block 00027 (SEQ ID No:216) , all four bispecific VHHs are analyzed in a human Ang2/hTie2-Fc (Figure 25) competition ELISA. This assay is also performed after incubation of the VHH with 0,5 pM human serum albumin. A summary of ICo values is shown in Table 40. Table 40: IC50 values (pM) in human Ang2/human Tie2 competition ELISA VHH ID Format HSA IC50 (pM) - 516 00027 0+ n.d. 2240 VEGFANGB1100001 463 VEGFANGBIIOOO 2 + 330 273 VEGFANGBIIOO03 VEGFANGBIIOOO04 + 92 2 AMG386 + n.d. n.d., not determined 121 WO 2012/131078 PCT/EP2012/055901 Example 11 Construction, production and characterization of trivalent and tetravalent bispecific VHHs targeting VEGF and Ang2 using anti-serum albumin binding as half-life extension Ten bispecific VHHs targeting VEGF and Ang2 are constructed (VEGFANGBII00005 00015). In these constructs monovalent and bivalent 1DO1 (SEQ ID NO:214), monovalent and bivalent 7G08 (SEQ ID NO:215) and bivalent 00027 (SEQ ID NO:216) anti-Ang2 building blocks are included. A genetic fusion to a serum albumin binding VHH is used as half-life extension methodology. Building blocks are linked via a 9 Gly Ser flexible linker. VHHs are produced and purified as described in Example 8. An overview of the format and sequence of all ten bispecific VHHs is depicted in Figure 26 and Table 41-A (linker sequences underlined), SEQ ID Nos 190-199. Expression levels are indicated in Table 41-B. Table 41-A Sequences of bispecific VHH targeting VEGF and Ang2 VHH ID AA sequence VEGFANGBII00005 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGGSLRLSCAASGFALDYYAIGWFRQVPGKEREGVSCISSSDGITYYVDSVKGR FTI SRDNAKNTVYLQMNSLKPEDTAVYYCATDSGGYIDYDCMGLGYDYWGQGTLVTVSSGGGGSGGG SEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKG RFTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSS (SEQ ID NO: 190) VEGFANGBII00006 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQPGGSLRLSCAASGFALDYYAIGWFRQVPGKEREGVSCISSSDGITYYVDSVKGRFTISRDNAKN TVYLQMNSLKPEDTAVYYCATDSGGYIDYDCMGLGYDYWGQGTLVTVSS (SEQ ID NO: 191) VEGFANGBII00007 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGGSLRLSCAASGFALDYYAIGWFRQVPGKEREGVSCISSSDGITYYVDSVKGR FTI SRDNAKNTVYLQMNSLKPEDTAVYYCATDSGGYIDYDCMGLGYDYWGQGTLVTVSSGGGGSGGG SEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKG RFTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGG GLVQPGGSLRLSCAASGFALDYYAIGWFRQVPGKEREGVSCISSSDGITYYVDSVKGRFTISRDNAK NTVYLQMNSLKPEDTAVYYCATDSGGYIDYDCMGLGYDYWGQGTLVTVSS (SEQ ID NO: 192) VEGFANGBII00008 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQAGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSSIRDNDGSTYYADSVKGR FTISSDNDKNTVYLQMNSLKPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSSGGGGS GGGSEVQLVESGGGLVQAGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSSIRDNDGSTYYADS VKGRFTISSDNDKNTVYLQMNSLKPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSSG GGGSGGGSEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTL YADSVKGRFTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSS (SEQ ID NO: 193) 122 WO 2012/131078 PCT/EP2012/055901 VEGFANGBII00009 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQAGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSSIRDNDGSTYYADSVKGRFTISSDNDKN TVYLQMNSLKPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSSGGGGSGGGSEVQLVE SGGGLVQAGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSSIRDNDGSTYYADSVKGRFTISSD NDKNTVYLQMNSLKPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSS (SEQ ID NO: 194) VEGFANGBII00010 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TIS RDNAKNTVYLQINS LRPEDTAVYYCASSPAYGSS RLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQAGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSSIRDNDGSTYYADSVKGR FTISSDNDKNTVYLQMNSLKPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSSGGGGS GGGSEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADS VKGRFTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVE SGGGLVQAGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSSIRDNDGSTYYADSVKGRFTISSD NDKNTVYLQMNSLKPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSS (SEQ ID NO: 195) VEGFANGBII00011 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQAGGSLRLSCAASGFTFDDYALGWFRQAAGKEREGVSCIRCSDGSTYYADSVKGR FTISSDNAKNTVYLQMNSLKPEDTAVYYCAASIVPRSKLEPYEYDAWGQGTLVTVSSGGGGSGGGSE VQLVESGGGLVQAGGSLRLSCAASGFTFDDYALGWFRQAAGKEREGVSCI RCSDGSTYYADSVKGRF TISSDNAKNTVYLQMNSLKPEDTAVYYCAASIVPRSKLEPYEYDAWGQGTLVTVSSGGGGSGGGSEV QLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGRFT ISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSS (SEQ ID NO: 196) VEGFANGBII00012 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQAGGSLRLSCAASGFTFDDYALGWFRQAAGKEREGVSCIRCSDGSTYYADSVKGRFTISSDNAKN TVYLQMNSLKPEDTAVYYCAASIVPRSKLEPYEYDAWGQGTLVTVSSGGGGSGGGSEVQLVESGGGL VQAGGSLRLSCAASGFTFDDYALGWFRQAAGKEREGVSCIRCSDGSTYYADSVKGRFTISSDNAKNT VYLQMNSLKPEDTAVYYCAASIVPRSKLEPYEYDAWGQGTLVTVSS (SEQ ID NO: 197) VEGFANGBII00013 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQAGGSLRLSCAASGFTFDDYALGWFRQAAGKEREGVSCIRCSDGSTYYADSVKGR FTISSDNAKNTVYLQMNSLKPEDTAVYYCAASIVPRSKLEPYEYDAWGQGTLVTVSSGGGGSGGGSE VQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGRF TISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGGL VQAGGSLRLSCAASGFTFDDYALGWFRQAAGKEREGVSCIRCSDGSTYYADSVKGRFTISSDNAKNT VYLQMNSLKPEDTAVYYCAASIVPRSKLEPYEYDAWGQGTLVTVSS (SEQ ID NO: 198) VEGFANGBII00014 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TIS RDNAKNTVYLQINS LRPEDTAVYYCASSPAYGSS RLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQAGGSLRLSCAASGFTFDDYALGWFRQAAGKEREGVSCIRCSDGSTYYADSVKGRFTISSDNAKN TVYLQMNSLKPEDTAVYYCAASIVPRSKLEPYEYDAWGQGTLVTVSS (SEQ ID NO: 199) Table 41-B VHH ID Expression (mg/L) VEGFANGBIIOOO05 1.3 VEGFANGBIIOOO06 1.3 VEGFANGBIIOOO07 0.3 123 WO 2012/131078 PCT/EP2012/055901 VEGFANGBIIOOO08 30.0 VEGFANGBII00009 71.4 VEGFANGBII00010 25.0 VEGFANGB110001 1 r f 4.0 VEGFANGBII00012 6.6 VEGFANGBII00013 2.9 VEGFANGBII00014 45.6 To explore the anti-VEGF blocking properties in comparison with the monovalent building block VEGFB1100038, all ten bispecific VHHs are analyzed in the VEGF/VEGFR2-Fc (Example 10; Figure 27-1) and VEGF/VEGFR1 (Figure 27-2) competition AlphaScreen. The VEGFR1 assay is slightly adjusted compared to Example 12.4 as described in patent US 2011/0172398 Al. Human VEGF165 and human VEGFRl-Fc are added at 0.05 nM. These competition assays are also performed after preincubation of the VHH with 25 pM human serum albumin. A summary of IC5o values is shown in Table 42. Table 42: IC5o values (nM) in human VEGF165/human VEGFR2 and human VEGF1 65/human VEGFR1 competition AlphaScreen VEGFR1 VEGFR2 VHH ID Format HSA % inh % inh (nM) (nM) - 0.6 67 0.5 100 VEGFB1100038 oo + 0.6 64 0.5 100 VEGFANGBIIOOO1 5 1000 - 0.8 64 1.0 100 VEGFANGB1100006 ~1 + 1.0 71 1.4 100 VEGFANGBIIOO07 B1 124 WO 2012/131078 PCT/EP2012/055901 V F B 0- 0.6 77 0.3 100 VEGFANGB1100008 B + 0.7 73 0.4 100 VEGFANGB1100009 0.8 71 0.4 100 + 1.5 72 0.7 100 - 0.5 72 0.3 100 VEG FANG B1100010 sBI + 1.1 78 0.7 100 - 0.6 68 0.4 100 VEGFANGB1100001 LB11 + 0.8 76 0.6 100 VEGFANGB1100011 0.8 74 0.9 100 + 2.5 81 0.8 100 - 1.0 74 0.4 100 VEGFANGBIIOOO12 LB1 + 1.5 80 0.7 100 VEGFANGBIIOOO13 LB1ot/ VEGFANGBIIOOO14 ". 6 11 1 + 1.0 80 0.7 100 - 2.5 92 1.2 100 Ranibizumab + 5.3 86 1.1 100 n.d., not determined To explore the anti-Ang2 blocking properties in comparison with their respective monovalent building block 7G08 (SEQ ID No:215), 1DO1 (SEQ ID No:214) and 00027 (SEQ ID No:216), all ten bispecific VHHs are analyzed in the human Ang2/hTie2-Fc (see Example 5.1; Figure 28-1), mouse Ang2/mTie2-Fc (see Example 5.2; Figure 28-2) and cyno Ang2/cTie2-Fc (see Example 5.2; Figure 28-3) competition ELISA. The human assay is also performed after incubation of the VHH with 0.5 pM human serum albumin. Additionally, a hAng2 mediated HUVEC survival assay is performed (see Example 5.5; Figure 29). A summary of IC5o values and % inhibition is shown in Table 43. 125 WO 2012/131078 PCT/EP2012/055901 0C000 00 0c 1 C)0 0 0 0 CNJ ~0 0 C) 0C O c 0 > 0 0 -o Dr 0 0 0 E~ o - 0 U)) < 000 0 0o 00 00 L 0 00 D) CN E 00 CN -r 00 (D Cu EO ol) O qO o N Cu4 ) Cu + + + co + + C: 00~~~ ~ o L 0 w 0 w 0 0 ~ 0 C) _ > r'- > 0> 0 >0 < 0 >0 > 0 1126 WO 2012/131078 PCT/EP2012/055901 0 0 0 0 0 0 0 0 0 0 Cl C9 I-: (q Cl co I o c 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 (0 mC 0o 00 C CC) Co CC) 0 CO) I'- ICO Co 00 00 0 00 0 0 000 000 00000 00000 0 0 0 0 -NMo0 00 + I + I + I + I + I + I + I + I + I + m z z CD C C C .0 7 < < 00 < < < < 00 0 C0L 0 0~~CC E 0 0J 0 U 0 LU 0 U 0 LU 0 0 > 0 > 0 < > >0 > 0 > 0 > 0 < 1 127 WO 2012/131078 PCT/EP2012/055901 Affinities of for human serum albumin have been determined and are shown in Table 44. Briefly, human serum albumin (Sigma, St Louis, MO, USA) is immobilized on a CM5 chip via amine coupling. A multicycle kinetic approach is used: increasing concentrations of VHH (2-8-31-125-500 nM) are injected and allowed to associate for 2 min and to dissociate for 10 min at a flow rate of 100 pL/min. Between VHH injections, the surfaces are regenerated with a 10 sec pulse of 10 mM Glycine-HCI pH 1.5 and 60 sec stabilization period. Association/dissociation data are evaluated by fitting a 1:1 interaction model (Langmuir binding) or Heterogeneous Ligand model. The affinity constant KD is calculated from resulting association and dissociation rate constants ka and kd (Table 44). WO 2012/131078 PCT/EP2012/055901 0( co 0 0 0 __D C Eo (0N1 U)LO LO) LO) LO ) 0D 0D 0C0 ++ + + U) w w o(0 r- C1 C - ~ (0 aN C4 cv) cv) (N4 0CD) CD CD) CD) CD) < (0- ) L 1 1 C-) LO) LO OLOL 0= 0 0D 0D 0D 0+2 + + + I- C') CO) LO N4 4-CD) CD) CD) CD) CD) CD) CD) co o 0(0 0 0o (0 0- 0D (D L O LO L O L O L C= =) C CD) CD 0D CD) U)LO Mt CD) Mt LO) Lo LO) LO-L~ ' 0 1- ) M ~ M C ) L v) ( C- C) (N CN C-C - - o4- U- Lt) U- U- co O- 0- - (N U- U Q o oo o 0 0 0 0 0 C E 3 w w w w w w w w w w F- 129 WO 2012/131078 PCT/EP2012/055901 Example 12 Construction, production and characterization of sequence optimized and affinity matured bispecific VHHs targeting VEGF and Ang2 using anti-serum albumin binding as half-life extension 14 bispecific VHHs targeting VEGF and Ang2 are constructed (VEGFANGBIIOOO15 00028). In these constructs bivalent 00921 (a sequence optimized 1 D01 variant) (SEQ ID No:220), monovalent VHHs 00908 - 00932 - 00933 - 00934 - 00935 - 00936 00937 - 00938 (sequence optimized/affinity matured 28D10 variants) (SEQ ID No:222), bivalent 00956 (SEQ ID NO:223) (sequence optimized 28D10 variant) and monovalent 00928 (SEQ ID NO:221) (sequence optimized 37F02 variant) anti-Ang2 building blocks are included. A genetic fusion to a serum albumin binding VHH is used as half-life extension methodology. Building blocks are linked via a 9 Gly-Ser flexible linker. An overview of the format and sequence of all 14 bispecific VHHs is depicted in Figure 30 and Table 45-A (linker sequences underlined), SEQ ID Nos 200-213. Expression levels are indicated in Table 45-B. Table 45-A Sequences of bispecific VHH targeting VEGF and Ang2 VHH ID AA sequence VEGFANGBII00015 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQPGGSLRLSCAASGITLDDYAIGWFRQAPGKEREGVSSIRDNGGSTYYADSVKGRFTISSDNSKN TVYLQMNSLRPEDTAVYYCAAVPAGRLRYGEQWYPIYEYDAWGQGTLVTVSS (SEQ ID NO: 200) VEGFANGBII00016 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQPGGSLRLSCAVSGITLDDYAIGWFRQAPGKEREGVSSIRDNGGSTYYADSVKGRFTISSDNSKN TVYLQMNSLRPEDTAVYYCAAVPAGRLRYGEQWYPIYEYDAWGQGTLVTVSS SEQ ID NO: 201) VEGFANGBII00017 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQPGGSLRLSCAASGITLDDYAIGWFRQAPGKEREGVSAIRDNGGSTYYADSVKGRFTISSDNSKN TVYLQMNSLRPEDTAVYYCAAVPAGRLRYGEQWYPIYEYDAWGQGTLVTVSS SEQ ID NO: 202) 130 WO 2012/131078 PCT/EP2012/055901 VEGFANGBII00018 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQPGGSLRLSCAASGITLDDYAIGWFRQAPGKEREGVSAIRESGGSTYYADSVKGRFTISSDNSKN TVYLQMNSLRPEDTAVYYCAAVPAGRLRYGEQWYPIYEYDAWGQGTLVTVSS SEQ ID NO: 203) VEGFANGBII00019 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TIS RDNAKNTVYLQINS LRPEDTAVYYCASSPAYGSS RLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQPGGSLRLSCAASGITLDDYAIGWFRQAPGKEREGVSAIRSSGGSTYYADSVKGRFTISSDNSKN TVYLQMNSLRPEDTAVYYCAAVPAGRLRYGEQWYPIYEYDAWGQGTLVTVSS SEQ ID NO: 204) VEGFANGBII00020 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TIS RDNAKNTVYLQINS LRPEDTAVYYCASSPAYGSS RLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQPGGSLRLSCAVSGITLDDYAIGWFRQAPGKEREGVSAIRDNGGSTYYADSVKGRFTISSDNSKN TVYLQMNSLRPEDTAVYYCAAVPAGRLRYGEQWYPIYEYDAWGQGTLVTVSS SEQ ID NO: 205) VEGFANGBII00021 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQPGGSLRLSCAVSGITLDDYAIGWFRQAPGKEREGVSAIRESGGSTYYADSVKGRFTISSDNSKN TVYLQMNSLRPEDTAVYYCAAVPAGRLRYGEQWYPIYEYDAWGQGTLVTVSS SEQ ID NO: 206) VEGFANGBII00022 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TIS RDNAKNTVYLQINS LRPEDTAVYYCASSPAYGSSPLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQPGGSLRLSCAVSGITLDDYAIGWFRQAPGKEREGVSAIRSSGGSTYYADSVKGRFTISSDNSKN TVYLQMNSLRPEDTAVYYCAAVPAGRLRYGEQWYPIYEYDAWGQGTLVTVSS SEQ ID NO: 207) VEGFANGBII00023 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQPGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSAIRDNGGSTYYADSVKGRFTISSDNSKN TVYLQMNSLRPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSSGGGGSGGGSEVQLVE SGGGLVQPGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSAIRDNGGSTYYADSVKGRFTISSD NSKNTVYLQMNSLRPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSS SEQ ID NO: 208) VEGFANGBII00024 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSAI RDNGGSTYYADSVKGR FTISSDNSKNTVYLQMNSLRPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSSGGGGS GGGSEVQLVESGGGLVQPGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSAIRDNGGSTYYADS VKGRFTISSDNSKNTVYLQMNSLRPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSSG GGGSGGGSEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTL YADSVKGRFTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSS SEQ ID NO: 209) VEGFANGBII00025 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQPGGSLRLSCAASGFTFDDYALGWFRQAPGKEREGVSCIRCSGGSTYYADSVKGRFTISSDNSKN TVYLQMNSLRPEDTAVYYCAASIVPRSKLEPYEYDAWGQGTLVTVSSGGGGSGGGSEVQLVESGGGL VQPGGSLRLSCAASGFTFDDYALGWFRQAPGKEREGVSCIRCSGGSTYYADSVKGRFTISSDNSKNT VYLQMNSLRPEDTAVYYCAASIVPRSKLEPYEYDAWGQGTLVTVSS SEQ ID NO: 210) 131 WO 2012/131078 PCT/EP2012/055901 VEGFANGBII00026 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGGSLRLSCAASGFTFDDYALGWFRQAPGKEREGVSCIRCSGGSTYYADSVKGR FTISSDNSKNTVYLQMNSLRPEDTAVYYCAASIVPRSKLEPYEYDAWGQGTLVTVSSGGGGSGGGSE VQLVESGGGLVQPGGSLRLSCAASGFTFDDYALGWFRQAPGKEREGVSCIRCSGGSTYYADSVKGRF TISSDNSKNTVYLQMNSLRPEDTAVYYCAASIVPRSKLEPYEYDAWGQGTLVTVSSGGGGSGGGSEV QLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGRFT ISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSS SEQ ID NO: 211) VEGFANGBII00027 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQPGGSLRLSCAASGFALDYYAIGWFRQAPGKEREGVSCISSSGGITYYADSVKGRFTISRDNSKN TVYLQMNSLRPEDTAVYYCATDSGGYIDYDCSGLGYDYWGQGTLVTVSS SEQ ID NO: 212) VEGFANGBII00028 DVQLVESGGGLVQPGGSLRLSCAASGRTFSSYSMGWFRQAPGKEREFVVAISKGGYKYDAVSLEGRF TISRDNAKNTVYLQINSLRPEDTAVYYCASSPAYGSSRLRLADTYEYWGQGTLVTVSSGGGGSGGGS EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGR FTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGG LVQPGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSAIRSSGGSTYYADSVKGRFTISSDNSKN TVYLQMNSLRPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSSGGGGSGGGSEVQLVE SGGGLVQPGGSLRLSCAASGFTLDDYAIGWFRQAPGKEREGVSAIRSSGGSTYYADSVKGRFTISSD NSKNTVYLQMNSLRPEDTAVYYCAAVPAGRLRFGEQWYPLYEYDAWGQGTLVTVSS SEQ ID NO: 213) Table 45-B VHH ID Format Expression (mg/L) VEGFANGB1100022 VEGFANGB1100025 VEGFANGB1100028 To explore the anti-VEGF blocking properties in comparison with the monovalent building block VEGFB1100038, the bispecific VHHs are analyzed in the VEGFNEGFR2 Fc (Example 10; Figure 31-1) and VEGFNEGFR1 (Example 11; Figure 31-2) competition AlphaScreen. These competition assays are also performed after preincubation of the VHH with 25 pM human serum albumin. A summary of IC5o values is shown in Table 46-A. 132 WO 2012/131078 PCT/EP2012/055901 Table 46-A IC5o values (nM) in human VEGF165/human VEGFR2 and human VEGF1 65/human VEGFR1 competition AlphaScreen VEGFR1 VEGFR2 VHH ID Format HSA % inh % inh (nM) (nM) - 0.4 57 0.2 100 VEGFB1100038 co U 0.4 64 0.2 100 VEGFANGB1100022 B VEFNB102 0.6 68 0.2 100 + 0.9 75 0.3 100 VEGFANGBI100028 ' LB - 0.5 64 0.2 100 + 0.5 64 0.2 100 - 3.2 97 0.7 100 Ranibizumab + 0.9 100 n.d., not determined Binding kinetics of the bispecific VHHs on human VEGF165 is analyzed by SPR on a Biacore T100 instrument (see Example 12.5 described in patent US 2011/0172398 Al). Monovalent Nanobody VEGFBI00038 is taken along as reference (Table 46-B). Table 46-B: Overview of kinetic parameters in hVEGF165 Biacore assay. kal kdl ka2 kd2 KD1 (1/Ms) (1/s) (1/s) (1/s) (M) VEGFBI100038 2.6E+05 1.3E-02 1.3E-02 1.9E-04 7.5E-10 VEGFANGBI100022 1.6E+05 1.4E-02 1.4E-02 2.2E-04 1.4E-09 VEGFANGBI100025 1.1E+05 1.4E-02 1.4E-02 2.1E-04 1.9E-09 VEGFANGBI100028 1.7E+05 1.3E-02 1.3E-02 2.1 E-04 1.1 E-09 The ability of the VHHs to bind to human isoform VEGF121 is determined in a binding ELISA. Binding of a dilution series of VHH to 1 pg/mL directly coated human VEGF121 133 WO 2012/131078 PCT/EP2012/055901 (R&D) (human VEGF165 as reference) is detected using biotinylated anti-VHH 1A4 followed by extravidin-HRP. 1A4 is a anti-VHH VHH (generated in-house by Ablynx NV). The benchmark Avastin serves as positive control and is detected using a HRP conjugated anti-human Fc antibody. An irrelevant VHH serves as negative control. Representative binding response curves on VEGF165 and VEGF121 are shown in Figure 46 corresponding EC 50 values are summarized in Table 46-C. Table 46-C: Overview of EC 50 values in hVEGF165 and hVEGF121 binding ELISA. hVEGF165 hVEGF121 EC 50 (M) EC 50 (M) VEGFANGBI100022 1.4E-09 2.3E-09 VEGFANGBI100025 1.5E-09 2.5E-09 VEGFANGBI100028 1.2E-09 2.1E-09 Binding to rat and mouse VEGF164 is assessed in a binding ELISA. VHHs binding to 1 pg/mL directly coated murine or rat VEGF164 (R&D) are detected using biotinylated anti-VHH 1A4 followed by extravidin-HRP. As positive control the mouse/rat cross reactive monoclonal antibody B20-4.1 (Genentech) is titrated and detected with an HRP conjugated anti-human Fc antibody. An irrelevant VHH serves as negative control. Results are shown in Figure 33. All 3 bispecific VHH are not cross-reactive to mouse and rat VEGF. Binding to human VEGF-B, VEGF-C, VEGF-D and PIGF is assessed via a binding ELISA. Binding of VHHs to 1 pg/mL directly coated VEGF-B (R&D), VEGF-C (R&D), VEGF-D (R&D) and PIGF (R&D) was detected using biotinylated anti-VHH 1A4 followed by extravidin-HRP. As positive controls a series of dilutions of the appropriate receptors (hVEGFR1 -Fc for hVEGF-B and hPIGF, hVEGFR2-Fc for hVEGF-C, anti-hVEGF-D mAb (R&D) for hVEGF-D) are taken along. An irrelevant VHH serves as negative control. Results are shown in Figure 34. All 3 bispecific VHH are not binding to VEGF family members. 134 WO 2012/131078 PCT/EP2012/055901 To explore the anti-Ang2 blocking properties in comparison with their respective monovalent building block 00921 (SEQ ID NO:220) and 00938 (SEQ ID NO:222), all 3 bispecific VHHs are analyzed in the human Ang2/hTie2-Fc (see Example 5.1; Figure 35-1), mouse Ang2/mTie2-Fc (see Example 5.2; Figure 35-2) and cyno Ang2/cTie2-Fc (see Example 5.2; Figure 35-3) competition ELISA. The human assay is also performed after incubation of the VHH with 0.5 pM human serum albumin. Additionally, bispecific VHHs are tested in the hAngl/hTie2 competition ELISA (see Example 5.3; Figure 36) and the Ang2 mediated HUVEC survival assay (see Example 5.5; Figure 37). A summary of IC5o values and % inhibition is shown in Table 47-A. 135 WO 2012/131078 PCT/EP2012/055901 C E * o - - C > 0 ~ Q ~ co 04 0 o1 cDr Lo - -) N qT8 lc 0. T- o o i 00 o o ) 0 0-.= c O C N ~ 0) (D () 04- ( SCU CO Or >0 LN - - Cr> (N R r .c O C CO O O O O o-- - - - - - (0 C< 0) CD A CO LrO L0 L CA A A A A A oA A 00 C1 c uJ .c O O OO O a yO ce 0 o o o o o O o Lo ow N 3(c w o < o 0 rO CO 0C C CO COo. (0 N U) < _ Co () U) U0 U) 0 - C- - CC - - CC - 0- 0- 00 E > - < 0 -) C) L _ o Ur> (D r - lc- r- o.D C) E 0< o 0 0(0 0 0 0 0 0 0 0 0 0 E -o w (C C U _ -0 EE CUO u a _ z C ozo E >U U) 0hL o _ 0o ( 0 0 C co - ,, Co ) LL Co (D LL Co) 0 WO 2012/131078 PCT/EP2012/055901 Affinities of VEGFANGBII00022-25-28 for human, mouse, cyno and rat Ang2 (see Example 5.4) have been determined and are shown in Table 47-B. Table 47-B: Affinity KD of purified VHHs for recombinant human, cyno, mouse 5 and rat Ang2 human Ang2-FLD cyno Ang2-FLD ka kd KD ka kd KD (1/Ms) (1/s) (M) (1/Ms) (1/s) (M) VEGFANGBI100022 9.7E+05 1.5E-05 1.6E-11 1.5E+06 1.3E-05 8.1E-12 VEGFANGBI100025 2.7E+06 1.2E-02 4.5E-09 4.3E+06 1.1E-02 2.7E-09 VEGFANGBI100028 5.9E+05 9.6E-04 1.6E-09 8.4E+05 8.7E-04 1.OE-09 mouse Ang2-FLD rat Ang2-FLD ka kd KD ka kd KD (1/Ms) (1/s) (M) (1/Ms) (1/s) (M) VEGFANGBI100022 5.5E+05 2.8E-05 5.1E-11 3.9E+05 3.8E-05 9.9E-11 VEGFANGBI100025 1.3E+06 1.4E-02 1.1E-08 8.7E+05 2.9E-02 3.3E-08 VEGFANGBI100028 3.6E+05 2.OE-03 5.6E-09 2.5E+05 3.1E-03 1.2E-08 Affinities of VEGFANGBII00022-25-28 for human, mouse and cyno serum albumin have been determined (Example 11) and are shown in Table 48. The 10 affinity constant KD is calculated from resulting association and dissociation rate constants ka and kd (Table 48). 137 WO 2012/131078 PCT/EP2012/055901 Table 48: Affinity KD (nM) of purified VHHs for recombinant human, mouse and cyno serum albumin using (A) 1:1 interaction model or (B) heterogeneous ligand model (A) HSA CSA ka kd KD ka kd KD (1/Ms) (1/s) (nM) (1/Ms) (1/s) (nM) ALB11 5.6E+05 1.9E-03 4 4.5E+05 1.7E-03 4 VEGFANGBI100022 6.7E+05 6.OE-03 9 6.2E+05 5.4E-03 9 VEGFANGBI100025 5.6E+05 5.6E-03 12 4.3E+05 5.1E-03 12 VEGFANGBI100028 5.6E+05 5.8E-03 10 5.2E+05 5.3E-03 10 5 MSA k, kd KD (1/Ms) (1/s) (nM) ALB11 5.9E+05 3.OE-02 51 VEGFANGBI100022 5.2E+05 5.4E-03 150 VEGFANGBI100025 - - VEGFANGBI100028 - - (B) MSA ka1 kdl ka2 kd2 KD 1 KD2 (1/Ms) (1/s) (1/s) (1/s) (nM) (nM) VEGFANGBI100025 6.2E+05 9.9E-02 4.7E+04 5.7E-04 160 * 12 VEGFANGBI100028 5.9E+04 6.9E-04 5.7E+05 9.4E-02 12 160 * * describes 70% or more of the interaction 138 WO 2012/131078 PCT/EP2012/055901 LON 0 UZ o CO NI 0'J 00 I- o U) r) 00 L o ( 0 o -c mm x x C U) uJu I CN 0 o _000 60 mmuu 00 mmm oo u mm C n -- ~ uu UUuu '--C ZN E o o E E E Eo o o > 1> AE ol a o > > > > > > a U) -- -- ( Uz -- - e e F-4 F- a o o o C u ~ ~ U U U U JU U C N a Uo o u D u -NT F w 0QE wQ Q Q 0 >) > > > > >> o : > > > > >0- -- -- > ->- >- -- -- -- ~-U) 00 0 >Ci QQ -QO -HQ Q Q Q - o T 139
权利要求:
Claims (40) [1] 1. A bispecific binding molecule comprising at least one VEGF-binding component, at least one Ang2-binding component and at least one 5 serum albumin binding component, wherein said Ang2-binding component binds to Ang2 with a potency at least 5,000 times higher than to Ang1 or to Ang4. [2] 2. A bispecific binding molecule of claim 1, wherein said VEGF-binding component comprises at least a variable domain with four framework 10 regions and three complementarity determining regions CDR1, CDR2 and CDR3, respectively, wherein said CDR3 has the amino acid sequence Ser Arg Ala Tyr Xaa Ser Xaa Arg Leu Arg Leu Xaa Xaa Thr Tyr Xaa Tyr as shown in SEQ ID NO: 1, wherein Xaa at position 5 is Gly or Ala; 15 Xaa at position 7 is Ser or Gly; Xaa at position 12 is Gly, Ala or Pro; Xaa at position 13 is Asp or Gly; Xaa at position 16 is Asp or Glu; and wherein said VEGF-binding component is capable of blocking the 20 interaction of human recombinant VEGF165 with the human recombinant VEGFR-2 with an inhibition rate of 60%. [3] 3. A bispecific binding molecule of claim 2, wherein said CDR3 has a sequence selected from SEQ ID NO: 2 SRAYGSSRLRLGDTYDY, 25 SEQ ID NO:3 SRAYGSSRLRLADTYDY; SEQ ID NO: 4 SRAYGSSRLRLADTYEY; SEQ ID NO: 5 SRAYGSGRLRLADTYDY; SEQ ID NO: 6 SRAYASSRLRLADTYDY; 140 WO 2012/131078 PCT/EP2012/055901 SEQ ID NO: 7 SRAYGSSRLRLPDTYDY, SEQ ID NO: 8 SRAYGSSRLRLPGTYDY. [4] 4. A bispecific binding molecule of claim 3, wherein said VEGF-binding component comprises one or more immunoglobulin single variable 5 domains each containing a. a CDR3 with an amino acid sequence selected from a first group of sequences shown in SEQ ID NO: 2 to 8; b. a CDR1 and a CDR2 with an amino acid sequences that is contained, as indicated in Table 3, in a sequence selected from a 10 second group of sequences shown in SEQ ID NOs: 9 to 46, wherein said second sequence contains the respective CDR3 in said selected sequence according to a). [5] 5. A bispecific binding molecule of claim 4, wherein said one or more immunoglobulin single variable domains are VHHs. 15 [6] 6. A bispecific binding molecule of claim 5, wherein said one or more VHHs have amino acid sequences selected from the amino acid sequences shown in SEQ ID NOs: 9 - 46. [7] 7. A bispecific binding molecule of claim 6, which comprises one or more VHHs having amino acid sequences selected from SEQ ID NO: 15, 20 SEQ ID NO: 18 and SEQ ID NO: 25. [8] 8. A bispecific binding molecule, the VEGF-binding component of which has been obtained by affinity maturation and/or sequence optimization of a VHH defined in claim 7. 141 WO 2012/131078 PCT/EP2012/055901 [9] 9. A bispecific binding molecule according to claim 8, the VEGF-binding component of which has been obtained by sequence optimization of a VHH having an amino acid sequence shown in SEQ ID NO: 18. [10] 10. A bispecific binding molecule according to claim 9, the VEGF-binding 5 component of which having an amino acid sequence selected from sequences shown in SEQ ID NOs: 47 - 57. [11] 11. A bispecific binding molecule according to claim 5, the VEGF-binding component of which comprising two or more VHHs, which are a. identical VHHs that are capable of blocking the interaction 10 between recombinant human VEGF and the recombinant human VEGFR-2 with an inhibition rate of 60% or b. different VHHs that bind to non-overlapping epitopes of VEGF, wherein at least one VHH is capable of blocking the interaction between recombinant human VEGF and the recombinant human 15 VEGFR-2 with an inhibition rate of 60% and wherein at least one VHH is capable of blocking said interaction with an inhibition rate of 5 60 %. [12] 12. A bispecific binding molecule according to claim 11, wherein said identical VHHs a) are selected from VHHs having amino acid 20 sequences shown in SEQ ID NOs: 9 - 46 or VHHs that have been obtained by affinity maturation and/or sequence optimization of such VHH. [13] 13. A bispecific binding molecule according to claim 12, wherein said VHH is selected from VHHs having the amino acid shown in SEQ ID NO: 18 25 or SEQ ID NO: 47 - 57. 142 WO 2012/131078 PCT/EP2012/055901 [14] 14. A bispecific binding molecule according to claim 13 comprising two VHHs each having the amino acid sequence shown in SEQ ID NO: 57. [15] 15. A bispecific binding molecule according to claim 14, wherein a. said one or more VHHs with an inhibition rate of 60% are 5 selected from i. VHHs having an amino acid sequence selected from amino acid sequences shown in SEQ ID NOs: 9 - 46 or ii. VHHs that have been obtained by affinity maturation and/or sequence optimization of such VHHs, and wherein 10 b. said one or more VHHs with an inhibition rate of 5 60 % are selected from i. SEQ ID NOs: 58 - 124 or ii. VHHs that have been obtained by affinity maturation and/or sequence optimization of such VHH. is [16] 16. A bispecific binding molecule according to claim 15, wherein two VHHs are contained in polypeptides with amino acid sequences shown in SEQ ID NOs: 128 - 168, separated by linker sequences as indicated in Table 13. [17] 17. A bispecific binding molecule according to claim 16, wherein said VHH 20 a) i. has an amino acid sequence shown in SEQ ID NO: 18 and said VHH b) i. has an amino acid sequence shown in SEQ ID NO: 64. [18] 18. A bispecific binding molecule according to claim 17, wherein said VHHs according to a) ii) are selected from VHHs having an amino acid sequence shown in SEQ ID NOs: 47 - 57 and wherein said VHHs 143 WO 2012/131078 PCT/EP2012/055901 according to b) ii) are selected from VHHs having an amino acid sequence shown in SEQ ID NOs: 125 - 127. [19] 19. A bispecific binding molecule according to claim 18, comprising two VHHs, one of them having the amino acid shown in SEQ ID NO: 57 and 5 one of them having the amino acid shown in SEQ ID NO: 127. [20] 20. The bispecific binding molecule of any one of claims 1 to 19, comprising an Ang2-binding component comprising at least a variable domain with four framework regions and three complementarity determining regions CDR1, CDR2 and CDR3, respectively, wherein said CDR3 has an 10 amino acid sequence selected from amino acid sequences shown in SEQ IDs NOs: 226, 229, 232, 235, 238, 241, 244, 247, 250, or 253. [21] 21. The bispecific binding molecule of claim 20, the Ang2-binding component of which is an isolated immunoglobulin single variable domain or a polypeptide containing one or more of said immunoglobulin 15 single variable domains, wherein said immunoglobulin single variable domain consists of four framework regions and three complementarity determining regions CDR1, CDR2 and CDR3, respectively, and wherein said CDR3 has an amino acid sequence selected from amino acid sequences shown in SEQ IDs NOs: 226, 229, 232, 235, 238, 241, 244, 20 247,250, or253. [22] 22. The bispecific binding molecule of claim 21, wherein said one or more immunoglobulin single variable domain contain a. a CDR3 with an amino acid sequence selected from a first group of amino acid sequences shown in SEQ ID NOs: SEQ IDs NOs: 25 226, 229, 232, 235, 238, 241, 244, 247, 250, or 253 (Table 49); 144 WO 2012/131078 PCT/EP2012/055901 b. a CDR1 with an amino acid sequences that is contained, as indicated in Table 36-A, 38-A, 41-A, or 45-A, as partial sequence in a sequence selected from a second group of amino acid sequences shown SEQ ID NOs: 224, 227, 230, 233, 236, 239, 5 242, 245, 248, or 251 (Table 49); c. a CDR2 with an amino acid sequences that is contained, as indicated in Table 36-A, 38-A, 41-A, or 45-A, as partial sequence in a sequence selected from a second group of amino acid sequences shown SEQ ID NOs:225, 228, 231, 234, 237, 240, 10 243, 246, 249, or 252 (Table 49). [23] 23. The bispecific binding molecule of any one of claims 20 to 22, wherein said one or more immunoglobulin single variable domains are VHHs. [24] 24. The bispecific binding molecule of claim 23, wherein said one or more VHHs have an amino acid sequence selected from amino acid 15 sequences shown in SEQ ID NOs: 214, 215, 216, 217, 218, 219, 220, 221, 222, or 223. [25] 25. An immunoglobulin single variable domain which has been obtained by affinity maturation of an immunoglobulin single variable domain as defined in claim 22. 20 [26] 26. A VHH which has been obtained by affinity maturation of a VHH as defined in claim 24. [27] 27. An Ang2-binding VHH with an amino acid sequence selected from acid sequences shown in SEQ ID NOs: 214, 215, 216, 217, 218, 219, 220, 221, 222, or 223. 25 [28] 28. An immunoglobulin single variable domain which has been obtained by humanization of a VHH defined in claim 27. 145 WO 2012/131078 PCT/EP2012/055901 [29] 29. An immunoglobulin single variable domain which has been obtained by humanization of an immunoglobulin single variable domain as defined in claim 22. [30] 30. The binding molecule of any one of claim 1 to 29, the serum albumin 5 binding component of which is an isolated immunoglobulin single variable domain or a polypeptide containing one or more of said immunoglobulin single variable domains, wherein said immunoglobulin single variable domain consists of four framework regions and three complementarity determining regions CDR1, CDR2 and CDR3, 10 respectively, and wherein said CDR3 has an amino acid sequence selected from amino acid sequences shown in SEQ ID NOs: 257, 260, 263, 266, 269, 272, or 275. [31] 31. The binding molecule of claim 30, wherein said one or more immunoglobulin single variable domain contain 15 a. a CDR3 with an amino acid sequence selected from a first group of amino acid sequences shown in SEQ ID NOs: SEQ IDs NOs: 257, 260, 263, 266, 269, 272, or 275; b. a CDR1 with an amino acid sequences selected from a second group of amino acid sequences shown SEQ ID NOs: 255, 258, 20 261, 264, 267, 270, or 273; c. a CDR2 with an amino acid sequences selected from a second group of amino acid sequences shown SEQ ID NOs: 256, 259, 262, 265, 268, 271, or 274. [32] 32. The bispecific binding molecule of claim 30 or 31, wherein said one or 25 more immunoglobulin single variable domains are VHHs. 146 WO 2012/131078 PCT/EP2012/055901 [33] 33. The bispecific binding molecule of claim 32, wherein said one or more VHHs have an amino acid sequence shown in SEQ ID NOs: 98 or 254. [34] 34. The bispecific binding molecule of any one of claims 1 to 33 having the amino acid sequence selected from amino acid sequences shown in 5 SEQ ID NOs: 180-213. [35] 35. A nucleic acid molecule encoding a bispecific binding molecule of any one of claims 1 to 34 or a vector containing same. [36] 36. A host cell containing a nucleic acid molecule of claim 35. [37] 37. A pharmaceutical composition containing at least one bispecific binding 10 molecule of any one of claims 1 to 34 as the active ingredient. [38] 38. The pharmaceutical composition of claim 37 for the treatment of a disease that is associated with VEGF- and/or Ang2-mediated effects on angiogenesis. [39] 39. The pharmaceutical composition of claim 38 for the treatment of cancer 15 and cancerous diseases. [40] 40. The pharmaceutical composition of claim 38 for the treatment of eye diseases. 20 147
类似技术:
公开号 | 公开日 | 专利标题 US11161916B2|2021-11-02|Bispecific binding molecules binding to VEGF and Ang2 US20200308267A1|2020-10-01|Vegf-binding molecules US20140120095A1|2014-05-01|Bispecific binding molecules for anti-angiogenesis therapy EP2483313A2|2012-08-08|Dll4-binding molecules TWI551612B|2016-10-01|Bispecific binding molecules binding to vegf and ang2 OA16601A|2015-11-20|Bispecific molecules binging to VEGF and Ang2. NZ614249B2|2015-09-01|Bispecific binding molecules binding to vegf and ang2
同族专利:
公开号 | 公开日 CN105820243A|2016-08-03| US10414828B2|2019-09-17| US20170247475A1|2017-08-31| JP6023786B2|2016-11-09| EA201600338A1|2016-09-30| MA34979B1|2014-03-01| US20220017642A1|2022-01-20| KR101907572B1|2018-10-15| EP3144322A2|2017-03-22| EP2694546A1|2014-02-12| AU2017200237B2|2018-05-17| MX337543B|2016-03-10| UA114707C2|2017-07-25| MX2013010949A|2014-06-06| PL2694546T3|2017-03-31| EA201301108A1|2014-03-31| HK1190412A1|2014-07-04| RS55361B1|2017-03-31| HK1225400A1|2017-09-08| US20200010569A1|2020-01-09| JP6297657B2|2018-03-20| WO2012131078A1|2012-10-04| ES2606302T3|2017-03-23| CO6801639A2|2013-11-29| HRP20161689T1|2017-02-24| AR085984A1|2013-11-13| AU2012237234B2|2016-10-20| NZ614249A|2015-05-29| BR112013025304A2|2017-06-06| US11161916B2|2021-11-02| MX343440B|2016-11-07| CL2013002623A1|2014-02-14| CA2827817A1|2012-10-04| CY1118339T1|2017-06-28| IL227936A|2018-06-28| MY171007A|2019-09-23| CN103562222A|2014-02-05| US9527925B2|2016-12-27| PT2694546T|2016-12-28| JP2014515602A|2014-07-03| EA025148B1|2016-11-30| IL227936D0|2013-09-30| SG193561A1|2013-11-29| SG10201602373TA|2016-05-30| HUE030148T2|2017-04-28| AU2017200237A1|2017-02-02| UY33998A|2012-09-28| JP2017023152A|2017-02-02| EA036746B1|2020-12-16| KR20140018317A|2014-02-12| DK2694546T3|2016-12-05| ECSP13013001A|2013-12-31| SI2694546T1|2017-01-31| PE20140448A1|2014-04-13| AP2013007085A0|2013-08-31| EP3144322A3|2017-05-31| US20130078248A1|2013-03-28| LT2694546T|2016-11-10| CA2827817C|2020-12-15| CN103562222B|2016-04-06| EP2694546B1|2016-09-21| TN2013000390A1|2015-01-20|
引用文献:
公开号 | 申请日 | 公开日 | 申请人 | 专利标题 DK0656946T4|1992-08-21|2010-07-26|Univ Bruxelles|Immunoglobulins without light chains| US5408535A|1993-09-07|1995-04-18|Miles Inc.|Video test strip reader and method for evaluating test strips| IL117645A|1995-03-30|2005-08-31|Genentech Inc|Vascular endothelial cell growth factor antagonists for use as medicaments in the treatment of age-related macular degeneration| EP0739981A1|1995-04-25|1996-10-30|Vrije Universiteit Brussel|Variable fragments of immunoglobulins -use for therapeutic or veterinary purposes| US6884879B1|1997-04-07|2005-04-26|Genentech, Inc.|Anti-VEGF antibodies| NZ500078A|1997-04-07|2001-10-26|Genentech Inc|Humanized anti-VEGF antibodies and their use in inhibiting VEGF-induced angiogenesis in mammals| US6329516B1|1997-04-28|2001-12-11|Fmc Corporation|Lepidopteran GABA-gated chloride channels| US7070959B1|1999-06-08|2006-07-04|Regeneron Pharmaceuticals, Inc.|Modified chimeric polypeptides with improved pharmacokinetic properties| JP2003530847A|2000-04-12|2003-10-21|ヒューマンゲノムサイエンシズインコーポレイテッド|Albumin fusion protein| JP2007534631A|2003-10-28|2007-11-29|ノボ ノルディスク アクティーゼルスカブ|Laminin-5γ2 binding peptides, related compositions and uses thereof| EP1361892A4|2001-01-17|2004-10-13|Trubion Pharmaceuticals Inc|Binding domain-immunoglobulin fusion proteins| AT477280T|2001-06-28|2010-08-15|Domantis Ltd|DOUBLE-SPECIFIC LIGAND AND ITS USE| US20050043220A1|2002-11-08|2005-02-24|Guyer David R.|Methods and compositions for treating macular degeneration| EP1537145A1|2002-09-10|2005-06-08|Lorantis Limited|Pharmaceutical compositions and medical treatments comprising notch ligand proteins| WO2003059934A2|2001-12-21|2003-07-24|Human Genome Sciences, Inc.|Albumin fusion proteins| AU2003217852A1|2002-03-01|2003-09-16|Ball Horticultural Company|Lis promoter for expression of transgenes in floral tissues| US20040110226A1|2002-03-01|2004-06-10|Xencor|Antibody optimization| EP2221317A3|2003-06-30|2011-07-27|Domantis Limited|PEGylated single domain antibodies | EP2284192A3|2002-11-08|2011-07-20|Ablynx N.V.|Camelidae antibodies for sublingual administration| KR20080113286A|2003-01-10|2008-12-29|아블린쓰 엔.브이.|Recombinant vhh single domain antibody from camelidae against von willebrand factor or against collagen| AU2003286003B2|2002-11-08|2011-05-26|Ablynx N.V.|Stabilized single domain antibodies| JP4490290B2|2002-12-31|2010-06-23|ネクターセラピューティクスアラバマ,コーポレイション|Hydrolytically stable maleimide terminated polymer| PL1660057T3|2003-08-27|2012-10-31|Ophthotech Corp|Combination therapy for the treatment of ocular neovascular disorders| ES2352697T3|2003-11-07|2011-02-22|Ablynx N.V.|CAMELIDAE VHH SINGLE DOMAIN ANTIBODIES DIRECTED AGAINST THE RECEIVER OF THE EPIDERMAL GROWTH FACTOR AND USES OF THE SAME.| US20050284249A1|2004-06-29|2005-12-29|Arnone David F|Worm type gear mover assembly| CA2583017A1|2004-10-13|2006-04-20|Ablynx N.V.|Single domain camelide anti-amyloid beta antibodies and polypeptides comprising the same for the treatment and diagnosis of degenerative neural diseases such as alzheimer's disease| US8048418B2|2004-10-29|2011-11-01|Regeneron Pharmaceuticals, Inc.|Therapeutic methods for inhibiting tumor growth with combination of Dll4 antagonists and VEGF antagonists| US20060134121A1|2004-10-29|2006-06-22|Gavin Thurston|DII4 antagonists, assays, and therapeutic methods thereof| AU2005316403A1|2004-12-17|2006-06-22|Genentech, Inc.|Antiangiogenesis therapy of autoimmune disease in patients who have failed prior therapy| WO2006068953A2|2004-12-21|2006-06-29|Astrazeneca Ab|Antibodies directed to angiopoietin-2 and uses thereof| US20070269422A1|2006-05-17|2007-11-22|Ablynx N.V.|Serum albumin binding proteins with long half-lives| SI1888641T1|2005-05-18|2012-05-31|Ablynx Nv|Serum albumin binding proteins| EP3415535B1|2005-05-20|2020-12-09|Ablynx N.V.|Improved nanobodies tm for the treatment of aggregation-mediated disorders| EP1910824A4|2005-05-31|2012-11-21|Labnow Inc|Methods and compositions related to determination and use of white blood cell counts| US7612181B2|2005-08-19|2009-11-03|Abbott Laboratories|Dual variable domain immunoglobulin and uses thereof| JP2009507796A|2005-09-01|2009-02-26|バスジーンセラピューティクス,インコーポレイテッド|Methods for using and identifying modulators of delta-like ligand 4| JPWO2007043109A1|2005-09-30|2009-04-16|富士通株式会社|Information storage device| CN103341168B|2005-12-15|2016-11-02|阿斯利康有限公司|The ANP-2 antagonist for the treatment of cancer and the combination of VEGF-A, KDR and/or Flt1 antagonist| PT1962895E|2005-12-16|2013-03-28|Regeneron Pharma|Therapeutic use of a dll4 antagonist and a vegf inhibitor for inhibiting tumor growth| US20110159003A1|2006-01-24|2011-06-30|Domantis Limited|Ligands That Bind Il-4 and/or Il-13| AR059066A1|2006-01-27|2008-03-12|Amgen Inc|COMBINATIONS OF THE ANGIOPOYETINE INHIBITOR -2 AND THE VASCULAR ENDOTELIAL GROWTH FACTOR INHIBITOR | US7570881B2|2006-02-21|2009-08-04|Nokia Corporation|Color balanced camera with a flash light unit| JP2009539384A|2006-06-06|2009-11-19|ジェネンテック・インコーポレーテッド|Anti-DLL4 antibody and method of using anti-DLL4 antibody| US20080014196A1|2006-06-06|2008-01-17|Genentech, Inc.|Compositions and methods for modulating vascular development| AU2007281916B2|2006-08-07|2012-06-28|Regeneron Pharmaceuticals, Inc.|methods for treating Ischemic Injury or Vascular Insuffciency| US8629244B2|2006-08-18|2014-01-14|Ablynx N.V.|Interleukin-6 receptor binding polypeptides| US20100113339A1|2006-09-08|2010-05-06|Ablynx N. V.|Serum albumin binding proteins with long half-lives| AU2007306340A1|2006-10-11|2008-04-17|Ablynx N.V.|Amino acid sequences that bind to serum proteins in a manner that is essentially independent of the pH, compounds comprising the same, and use thereof| JP2010507594A|2006-10-20|2010-03-11|シェーリングコーポレイション|Fully human anti-VEGF antibodies and methods of use| RU2448979C2|2006-12-14|2012-04-27|Ридженерон Фармасьютикалз, Инк.|Human antibodies to delta-like human ligand-4| WO2008101985A2|2007-02-21|2008-08-28|Ablynx N.V.|Amino acid sequences directed against vascular endothelial growth factor and polypeptides comprising the same for the treatment of conditions and diseases characterized by excessive and/or pathological angiogenesis or neovascularization| US10259860B2|2007-02-27|2019-04-16|Aprogen Inc.|Fusion proteins binding to VEGF and angiopoietin| CN104497143B|2007-03-29|2020-08-25|健玛保|Bispecific antibody and method for producing same| GB0709333D0|2007-05-15|2007-06-20|Smart Targeting Ltd|Binding protein| CA2683801A1|2007-06-06|2008-12-11|Domantis Limited|Polypeptides, antibody variable domains and antagonists| CA2683791A1|2007-06-06|2008-12-11|Domantis Limited|Polypeptides, antibody variable domains & antagonists| EP2014680A1|2007-07-10|2009-01-14|Friedrich-Alexander-Universität Erlangen-Nürnberg|Recombinant, single-chain, trivalent tri-specific or bi-specific antibody derivatives| MX2010004327A|2007-10-22|2010-05-13|Schering Corp|Fully human anti-vegf antibodies and methods of using.| MX2010005603A|2007-11-26|2010-08-02|Bayer Schering Pharma Ag|Anti-mesothelin antibodies and uses therefor.| WO2009095489A2|2008-02-01|2009-08-06|Ablynx N.V.|Improved amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of diseases and disorders associated with il-6-mediated signalling| JO2913B1|2008-02-20|2015-09-15|امجين إنك,|Antibodies directed to angiopoietin-1 and angiopoietin-2 and uses thereof| DE112009000507T5|2008-03-05|2011-02-10|Ablynx Nv|Novel antigen-binding dimer complexes, process for their preparation and their use| WO2009117277A2|2008-03-18|2009-09-24|Genentech, Inc.|Combinations of an anti-her2 antibody-drug conjugate and chemotherapeutic agents, and methods of use| US8557965B2|2008-04-07|2013-10-15|Ablynx N.V.|Single variable domains against notch pathway members| AU2009241589B2|2008-04-29|2013-10-10|Abbvie Inc.|Dual variable domain immunoglobulins and uses thereof| US20100260668A1|2008-04-29|2010-10-14|Abbott Laboratories|Dual Variable Domain Immunoglobulins and Uses Thereof| US9193780B2|2008-06-05|2015-11-24|Ablynx N.V.|Amino acid sequences directed against envelope proteins of a virus and polypeptides comprising the same for the treatment of viral diseases| CN110372792A|2008-06-25|2019-10-25|艾斯巴技术-诺华有限责任公司|Inhibit the stabilization and soluble antibodies of VEGF| AU2009288167B2|2008-09-03|2015-10-22|Genentech, Inc.|Multispecific antibodies| WO2010032060A1|2008-09-19|2010-03-25|Medimmune Llc|Antibodies directed to dll4 and uses thereof| US8268314B2|2008-10-08|2012-09-18|Hoffmann-La Roche Inc.|Bispecific anti-VEGF/anti-ANG-2 antibodies| CN102307902B|2008-12-10|2016-02-24|埃博灵克斯股份有限公司|Be used for the treatment of and the aminoacid sequence for angiogenin/Tie system of relevant disease and illness occur to blood vessel and comprises its polypeptide| US8133979B2|2008-12-16|2012-03-13|Hoffmann-La Roche Inc.|Antibodies against human angiopoietin 2| BRPI1007141A2|2009-01-13|2018-02-20|Fio Corporation|portable diagnostic test device and method for use with an electronic device and test cartridge in a rapid diagnostic test| WO2010124009A2|2009-04-21|2010-10-28|Schering Corporation|Fully human anti-vegf antibodies and methods of using| WO2010129304A2|2009-04-27|2010-11-11|Oncomed Pharmaceuticals, Inc.|Method for making heteromultimeric molecules| MX2011013781A|2009-06-17|2012-05-29|Abbott Biotherapeutics Corp|Anti-vegf antibodies and their uses.| JO3182B1|2009-07-29|2018-03-08|Regeneron Pharma|High Affinity Human Antibodies to Human Angiopoietin-2| US20110195494A1|2009-10-02|2011-08-11|Boehringer Ingelheim International Gmbh|Dll4-binging molecules| UY32920A|2009-10-02|2011-04-29|Boehringer Ingelheim Int|BISPECIFIC UNION MOLECULES FOR ANTI-ANGIOGENESIS THERAPY| KR101839161B1|2010-02-23|2018-03-16|제넨테크, 인크.|Anti-angiogenesis therapy for the treatment of ovarian cancer| AR080794A1|2010-03-26|2012-05-09|Hoffmann La Roche|BIVING SPECIFIC ANTIBODIES ANTI-VEGF / ANTI-ANG-2| WO2012012499A1|2010-07-20|2012-01-26|Nurx Pharmaceuticals, Inc.|Optical reader system| US20120225081A1|2010-09-03|2012-09-06|Boehringer Ingelheim International Gmbh|Vegf-binding molecules| US20120258108A1|2010-11-02|2012-10-11|Abbott Laboratories|Dual Variable Domain Immunoglobulins and Uses Thereof| US20130078247A1|2011-04-01|2013-03-28|Boehringer Ingelheim International Gmbh|Bispecific binding molecules binding to dii4 and ang2| US9527925B2|2011-04-01|2016-12-27|Boehringer Ingelheim International Gmbh|Bispecific binding molecules binding to VEGF and ANG2| KR20140043351A|2011-05-27|2014-04-09|노파르티스 아게|Method of treating vision disorders| CN104168914B|2011-09-23|2017-08-08|昂考梅德药品有限公司|VEGF/DLL4 bonding agents and its application| NZ628584A|2012-03-30|2016-04-29|Boehringer Ingelheim Int|Ang2-binding molecules|US9556273B2|2010-03-29|2017-01-31|Vib Vzw|Anti-macrophage mannose receptor single variable domains for targeting and in vivo imaging of tumor-associated macrophages| US9101674B2|2010-03-29|2015-08-11|Vib Vzw|Targeting and in vivo imaging of tumor-associated macrophages| US9527925B2|2011-04-01|2016-12-27|Boehringer Ingelheim International Gmbh|Bispecific binding molecules binding to VEGF and ANG2| NZ628584A|2012-03-30|2016-04-29|Boehringer Ingelheim Int|Ang2-binding molecules| PL3495387T3|2012-07-13|2022-01-10|Roche Glycart Ag|Bispecific anti-vegf/anti-ang-2 antibodies and their use in the treatment of ocular vascular diseases| CN104661678A|2012-09-28|2015-05-27|勃林格殷格翰国际有限公司|Pharmaceutical combinations comprising dual angiopoietin-2 /Dll4 binders and anti-VEGF-R agents| MX2015003894A|2012-09-28|2015-07-17|Boehringer Ingelheim Int|Pharmaceutical combinations comprising dual angiopoietin-2 / dll4 binders and anti-vegf agents.| AR100270A1|2014-05-19|2016-09-21|Lilly Co Eli|ANTIBODIES ANG2| AU2016207112B2|2015-01-16|2018-08-02|Academia Sinica|Molecular constructs with targeting and effector elements| AR103477A1|2015-01-28|2017-05-10|Lilly Co Eli|VEGFA / ANG2 COMPOUNDS| CA2981103A1|2015-03-31|2016-10-06|Vhsquared Limited|Polypeptides| SG11201706839YA|2015-03-31|2017-09-28|Vhsquared Ltd|Polypeptides| US10266589B2|2015-07-29|2019-04-23|Allergan, Inc.|Heavy chain only antibodies to ANG-2| US10308711B2|2015-08-14|2019-06-04|Allergan, Inc.|Heavy chain only antibodies to PDGF| JP6959912B2|2015-09-23|2021-11-05|ジェネンテック, インコーポレイテッド|Optimized variant of anti-VEGF antibody| AU2016351710A1|2015-11-13|2018-05-10|Ablynx Nv|Improved serum albumin-binding immunoglobulin variable domains| HUE051777T2|2015-12-04|2021-03-29|Boehringer Ingelheim Int|Biparatopic polypeptides antagonizing wnt signaling in tumor cells| CN109863172A|2016-08-23|2019-06-07|免疫医疗有限公司|Anti-vegf-A antibody and application thereof| AU2017315075B2|2016-08-23|2020-10-01|Medimmune Limited|Anti-VEGF-A and anti-ANG2 antibodies and uses thereof| BR112019012062A2|2016-12-14|2019-11-12|Progenity Inc|treating a gastrointestinal tract disease with a jak inhibitor and devices| RU2648164C1|2016-12-19|2018-03-22|Федеральное государственное учреждение науки Институт биоорганической химии им. академиков М.М. Шемякина и Ю.А. Овчинникова Российской академии наук |Selective bifunctional drug on the basis of fragments of camelized single-chain antibodies, aimed to oncotic receptors cd47/erbb2, intended for the therapy of malignant neoplasms| WO2018114728A1|2016-12-20|2018-06-28|F. Hoffmann-La Roche Ag|Combination therapy with a bispecific anti-ang2/vegf antibody and a bispecific anti-her2 antibody| CN110637030A|2017-05-31|2019-12-31|勃林格殷格翰国际有限公司|Polypeptide for antagonizing Wnt signaling in tumor cells| EP3630822A1|2017-06-02|2020-04-08|Boehringer Ingelheim International GmbH|Anti-cancer combination therapy| WO2019154776A1|2018-02-06|2019-08-15|F. Hoffmann-La Roche Ag|Treatment of ophthalmologic diseases| WO2020263312A1|2019-06-28|2020-12-30|Gensun Biopharma, Inc.|ANTITUMOR ANTAGONIST CONSISTING OF A MUTATED TGFβ1 - RII EXTRACELLULAR DOMAIN AND AN IMMUNOGLOBULIN SCAFFOLD| CN112638401A|2018-06-29|2021-04-09|璟尚生物制药公司|Antitumor antagonists| SG11202103064YA|2018-10-29|2021-05-28|Hoffmann La Roche|Antibody formulation| WO2021155151A1|2020-01-29|2021-08-05|The Methodist Hospital System|Multivalent ligands targeting cell surface receptors and force measurement platform for making the same| WO2021209458A1|2020-04-14|2021-10-21|Ares Trading S.A.|Combination treatment of cancer|
法律状态:
2017-02-16| FGA| Letters patent sealed or granted (standard patent)|
优先权:
[返回顶部]
申请号 | 申请日 | 专利标题 EP11160921.0||2011-04-01|| EP11160921||2011-04-01|| PCT/EP2012/055901|WO2012131078A1|2011-04-01|2012-03-30|Bispecific binding molecules binding to vegf and ang2|AU2017200237A| AU2017200237B2|2011-04-01|2017-01-13|Bispecific binding molecules binding to VEGF and Ang2| 相关专利
Sulfonates, polymers, resist compositions and patterning process
Washing machine
Washing machine
Device for fixture finishing and tension adjusting of membrane
Structure for Equipping Band in a Plane Cathode Ray Tube
Process for preparation of 7 alpha-carboxyl 9, 11-epoxy steroids and intermediates useful therein an
国家/地区
|